(data stored in ACNUC29543 zone)

EMBL: CP001044.PE207

CP001044.PE207       Location/Qualifiers
FT   CDS_pept        complement(256390..257211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3320"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: reh:H16_B1943
FT                   putative non-heme chloroperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3320"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72476"
FT                   /db_xref="GOA:B2JS99"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS99"
FT                   /protein_id="ACC72476.1"
FT                   /translation="MSTITTKDGTQIFYKDWGTGRPVVFSHGWPLDADAWDAQMLFLLR
FT                   NGFRVIAHDRRGHGRSDQPATGNDMDTYADDLAALLDALDIQGATLVGHSTGGGEVAHY
FT                   IGRHGTKRVAKAVLIGAVPPLMLKTEANPGGLPMDVFDGIRKGVADNRSQFYKDLAVPF
FT                   FGFNRQGSKVSQGTIDAFWAQGMAGGIHGQFLCIREFSEVDYTEDLKKIDVPTLILHGD
FT                   DDQIVPIDAAGKLSAKIVKNATFKIYEGGAHGMCVTEADKVNADLLAFINS"
     atgagcacga tcaccacgaa ggatggcacg cagattttct acaaggattg gggtacgggc        60
     cgtcccgtcg tgttttcgca cggctggccg ctcgatgccg acgcgtggga cgcgcagatg       120
     ctgttcctgc tgcgcaacgg ctttcgcgtg atcgcgcatg atcgccgcgg tcatggccgc       180
     tcggaccagc cggcgacggg caacgacatg gacacctacg ccgacgatct cgccgcactg       240
     ctcgatgcgc tcgacattca gggtgcgacg ctcgtcggcc attcgacggg cggcggcgaa       300
     gtcgcgcatt acatcggccg tcacggcacg aagcgcgtcg cgaaggcggt gctgatcggc       360
     gccgtgccgc cgctgatgct gaaaacggaa gcgaatccgg gcggtctgcc gatggacgtg       420
     ttcgacggca tccgcaaggg cgtcgccgat aaccgctcgc agttctacaa ggatctcgcg       480
     gtgccgttct tcggcttcaa ccggcagggc tcgaaggtat cgcaaggcac gatcgacgcc       540
     ttctgggcgc agggcatggc gggcggcatc cacggccagt tcctgtgcat ccgtgagttt       600
     tcggaagtcg attacacgga agacctgaag aagatcgacg tcccgacgtt gatcctgcac       660
     ggcgacgacg accagatcgt gcccatcgac gcagccggca agctgtccgc gaagatcgtc       720
     aaaaacgcga cgttcaagat ctacgaaggc ggcgcgcacg gcatgtgcgt gacggaagcc       780
     gacaaggtca acgccgatct gcttgcattc atcaacagct ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page