(data stored in ACNUC29543 zone)

EMBL: CP001044.PE209

CP001044.PE209       Location/Qualifiers
FT   CDS_pept        complement(259036..259350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syf:Synpcc7942_0709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3322"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72478"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA1"
FT                   /protein_id="ACC72478.1"
FT                   /translation="MKRFHIALAVANLDVSIDDYSRRLGQPPSAVVPGQYAMWRTDLLN
FT                   FSINEKPEQAGQLRHVGFEDDFVDGYSSSVDVNGLEWELFSAAEQDRRIVGTYGVPVKR
FT                   "
     atgaagcgct ttcacattgc attggccgtt gcgaatctcg acgtatcgat cgacgactac        60
     agccgccgtc tcggacaacc gccatcggct gtggtgccgg gacagtatgc aatgtggcgc       120
     accgacctgc tcaacttctc gattaatgaa aagccggaac aagcagggca attgcgccat       180
     gtcggtttcg aggatgactt tgtcgacggc tattcgagca gcgtcgacgt gaacgggctc       240
     gagtgggagc tgttttccgc ggcggagcag gacaggcgca tcgtcggcac gtacggcgtt       300
     cctgtgaagc gctga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page