(data stored in ACNUC29543 zone)

EMBL: CP001044.PE210

CP001044.PE210       Location/Qualifiers
FT   CDS_pept        259497..259889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3323"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rme:Rmet_4639
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3323"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72479"
FT                   /db_xref="GOA:B2JSA2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA2"
FT                   /protein_id="ACC72479.1"
FT                   /translation="MLSHVFIGVNDFERAFDFYSTVLGELGLALKFREDDRPWAGWMKP
FT                   GVARPLFLVGKPFDGQPAEPGNGAMVALLAADRLTVKRVHATALAQGATCEGPPGLRPE
FT                   YHANYYGAYFRDPDGNKLCVCCHGPA"
     atgctttccc acgtgtttat cggcgttaac gatttcgagc gggcgtttga tttctattcg        60
     acggtactcg gcgagctcgg gctcgcgttg aagttccgtg aagacgacag gccgtgggca       120
     ggatggatga agcccggcgt cgcgcggccg ctgtttctcg tgggcaagcc gttcgacggc       180
     cagcctgccg agccgggcaa cggcgcgatg gtcgcactgc tggcagctga ccgtctcacc       240
     gtcaagcgcg tgcacgcgac ggcgctcgca cagggcgcca cctgtgaagg tccgccaggg       300
     ctgcgccccg aataccacgc gaactactac ggcgcgtact ttcgcgatcc cgacggcaac       360
     aagctttgcg tgtgctgtca cggccctgcg tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page