(data stored in ACNUC29543 zone)

EMBL: CP001044.PE212

CP001044.PE212       Location/Qualifiers
FT   CDS_pept        261296..262348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3325"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bxe:Bxe_B1754 zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3325"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72481"
FT                   /db_xref="GOA:B2JSA4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA4"
FT                   /protein_id="ACC72481.1"
FT                   /translation="MTTTYAYAATDAQSKLAPFEFQRRDLREHDVQMEVLFCGVCHSDL
FT                   HQARNEWKNTIFPVVPGHEIVGRVTNVGSQVTKYKVGQLVGVGCLVDSCRTCPSCQEGL
FT                   EQYCENGFVGTYNGNDRQTGAVTYGGYSTQLVVDEDFVLRVPENLDPAGVAPLLCAGIT
FT                   LYSPLRTWGAGPGKKVGIVGLGGLGHMGVKLAHAMGAHVVLFTTSVSKIEDAKRLGADE
FT                   VVISKNPAEMEAHVNSFDLIVNTVAAQHDLNPFINLLKRDGTLTLVGAPEHDHPSPQVF
FT                   NLIMKRRRLAGSLIGGIAETQEMLDFCGKHGITSDIEMIQMQQINEAYERMLKSDVKYR
FT                   FVIDLDSLRK"
     atgaccacga cctacgccta tgccgcaacc gacgcgcaat cgaaactcgc gccgttcgaa        60
     tttcagcgtc gcgatctgcg cgaacacgat gtacagatgg aagtcctgtt ttgcggcgtc       120
     tgtcattcgg acttgcatca ggcacgcaac gaatggaaga acacgatttt ccccgtcgtc       180
     cccggccatg agattgtcgg ccgcgtgacg aacgtcgggt cgcaggtgac gaaatacaag       240
     gtgggccagc tggtcggcgt cggctgcctg gtcgattcgt gccgcacttg tcccagctgc       300
     caggaaggtc tcgaacagta ttgcgagaat ggcttcgtcg gcacgtacaa cggcaacgac       360
     cgtcagacag gcgcggtgac gtatggcggc tattcgacgc aactcgtcgt cgatgaagac       420
     ttcgtgctgc gcgtgccgga gaacctcgat ccggcaggcg tcgcgccgct gctgtgcgcg       480
     ggcatcacgc tgtactcgcc gctgcgcacg tggggcgcgg gaccgggcaa gaaggtcggc       540
     attgtcggtc tgggcggcct cggccacatg ggcgtgaagc tcgcgcacgc gatgggcgcg       600
     cacgtcgtgc tgttcacgac ctcggtctcg aagatcgagg atgcgaaacg cctcggtgcc       660
     gacgaagtgg tgatctcgaa gaacccggcg gagatggaag cgcatgtgaa cagcttcgat       720
     ctgatcgtca acacggtcgc cgcgcagcac gatctgaatc cgttcatcaa cctgctgaag       780
     cgtgacggca cgctgacgct ggtgggtgcg ccggagcacg atcatccgtc gccgcaggtg       840
     ttcaacctga tcatgaagcg ccgccgtctg gcgggttcgc tgatcggcgg cattgcggag       900
     acccaggaga tgctggattt ctgcggcaag cacggcatca cctcggacat cgagatgatc       960
     cagatgcagc agatcaatga agcatatgag cgcatgttga agagcgatgt gaaataccgc      1020
     ttcgtcatcg atctcgactc gctccgcaag taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page