(data stored in ACNUC29543 zone)

EMBL: CP001044.PE214

CP001044.PE214       Location/Qualifiers
FT   CDS_pept        complement(263456..263881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3327"
FT                   /product="polymorphic membrane protein, filamentous
FT                   haemagglutinin/adhesin"
FT                   /note="KEGG: bxe:Bxe_A2858 polymorphic membrane protein,
FT                   filamentous haemagglutinin/adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3327"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72483"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA6"
FT                   /protein_id="ACC72483.1"
FT                   /translation="MAVEETATAAGKSAGETRATGRASTKPAHSPLRNLIALMLAIAPP
FT                   LAFAQIVPGGAHAPNVITTQNGVPQVNITQPSSGSRVSVNTYGQFDISKSGAILNNSPT
FT                   IVNAQLAGYINGNPNFGPNDAAQQSIKPHASDPAATS"
     gtggccgtcg aggaaaccgc caccgctgcc ggaaaatctg ccggcgagac gcgcgcaaca        60
     ggccgcgcat caacgaaacc agcacattca ccgcttcgca atctgatcgc gctcatgctg       120
     gctatcgcgc ccccgctggc gttcgcgcag atcgttccgg gcggcgcgca cgcaccgaac       180
     gtcatcacga cgcagaacgg tgtcccgcag gtgaatatca cgcagccgtc ttctggctcc       240
     cgtgtttcgg tcaataccta cggccagttc gatatctcaa agtctggcgc gatcctcaac       300
     aattcgccga ccatcgttaa cgcacagctt gcgggctata tcaatggcaa cccgaacttc       360
     gggccgaacg atgccgcgca acaaagcatc aaaccgcatg caagcgaccc tgcagcaaca       420
     tcctga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page