(data stored in ACNUC29543 zone)

EMBL: CP001044.PE216

CP001044.PE216       Location/Qualifiers
FT   CDS_pept        complement(264726..265139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3329"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="PFAM: dihydroneopterin aldolase; KEGG: bps:BPSS1365
FT                   putative dihydroneopterin aldolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3329"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72485"
FT                   /db_xref="GOA:B2JSA8"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA8"
FT                   /protein_id="ACC72485.1"
FT                   /translation="MPPPVRGKGWRVFVDELVVSTRIGIHAHEHLAPQPVVIDASLAYR
FT                   CEPSEEGTHAMIDYERYCNRVSEFLSTKTHTRMLETLAVEIAQLSFDEWPALDALTLSL
FT                   YKPKIREGTRRIGVELDWTRADYDVHRTSDVAG"
     atgccaccgc cggtgcgggg aaagggctgg cgcgtgtttg tcgacgagtt ggtggtatcg        60
     acgcgcattg gcattcatgc gcacgagcat ctcgcgccgc agcctgtcgt gatcgacgcg       120
     agcctggctt atcgctgcga gccttcggaa gagggcacgc acgcgatgat cgactatgag       180
     cgttactgca atcgcgtgag cgagtttctt tcgacgaaga cgcatacgcg gatgctggag       240
     acgctggccg tggagatcgc gcagttgtcg ttcgacgaat ggccggcgct cgatgcgctc       300
     acgttgtcgc tctacaagcc gaagattcgc gagggcacga ggcggatcgg cgtggaactc       360
     gactggacgc gggcggatta tgacgtgcat cgcacgtcgg atgttgcggg ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page