(data stored in ACNUC29543 zone)

EMBL: CP001044.PE219

CP001044.PE219       Location/Qualifiers
FT   CDS_pept        complement(268805..269104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3332"
FT                   /product="Sarcosine oxidase delta subunit heterotetrameric"
FT                   /note="PFAM: Sarcosine oxidase delta subunit
FT                   heterotetrameric; KEGG: bxe:Bxe_B1599 SoxD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3332"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72488"
FT                   /db_xref="GOA:B2JSB1"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSB1"
FT                   /protein_id="ACC72488.1"
FT                   /translation="MLMIECPWCGPRAESEFSCGGEADIARPLDTDKLTDREWGDYLFM
FT                   RKNPRGVHREQWMHTQGCRRWFMATRDTVSYNIQGYDTFKTGNTSADSQGGNKQ"
     atgctgatga tcgaatgccc gtggtgcggg ccgcgcgccg aatccgaatt tagctgtggc        60
     ggcgaagccg acattgcgcg tccgctcgac accgacaagc tcaccgaccg cgaatggggc       120
     gactacctgt tcatgcgcaa gaatccgcgt ggcgtgcatc gcgagcaatg gatgcacacg       180
     caaggctgcc gccgctggtt catggcgacg cgcgacaccg tctcgtacaa catccagggt       240
     tacgacacgt tcaagacggg caacacgtcc gccgattccc aagggggcaa caagcaatga       300
//

If you have problems or comments...

PBIL Back to PBIL home page