(data stored in ACNUC29543 zone)

EMBL: CP001044.PE22

CP001044.PE22        Location/Qualifiers
FT   CDS_pept        complement(17953..19107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3123"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   bxe:Bxe_B2067 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3123"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72291"
FT                   /db_xref="GOA:B2JR65"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR65"
FT                   /protein_id="ACC72291.1"
FT                   /translation="MSVTVRRIAHLDMDAFYASVELLRYPELRGMPVVIGGGRNAAPET
FT                   LADGTRRFARLKDYAGRGVVTTSTYEARASGVFSAMGMMKAAQLAPDAILLPTDFDSYR
FT                   HYSRLFKIEVAKFTTRIEDRGIDEIYIDLTDVPGDAANIGSRIKEAVRAATGLTCSICV
FT                   APNKLLAKIGSELDKPDGLTILTPEDIPSRIWPLAARKINGIGPKASERLATLGINTVG
FT                   DLAHAAPDLLQSNFGLKYATWLTHVARGIDERPVVVESEPKSMSRETTFERDLHPRHDR
FT                   PALSESFTRLCVRVAEDLQRKGYVGHTIGIKLRFDDFSTVTRDLTLPVATSDAGAIRRA
FT                   ATECLKRVALTRKLRLLGVRVSGLSLASEQAPPLPIQAELPFTA"
     atgagtgtca ctgtccgccg tatcgcgcat ctcgacatgg acgcgttcta cgcatccgtc        60
     gaattgctgc gctatccgga gttgcgtggt atgccagtcg tgatcggcgg agggcgcaat       120
     gcggcgcccg aaacgctggc tgacggtaca cgccgttttg cgcgactgaa ggattacgca       180
     ggacgaggcg tcgttacaac ctcgacctac gaggcgcgcg cctctggcgt cttctcggcg       240
     atgggcatga tgaaggccgc gcagctcgcg cccgacgcca tcctcctgcc caccgacttc       300
     gattcctacc gccactactc gcgcctcttc aagattgaag tagcgaagtt cacgacacgt       360
     atcgaagacc gcggcatcga cgagatctat atcgacctca ccgacgtgcc cggcgatgcc       420
     gccaacatcg gctcgcgcat caaggaggca gtccgcgccg cgacgggcct gacgtgttcg       480
     atctgcgtcg ccccgaacaa actgctcgcc aagatcggct cagaactcga caagcccgac       540
     ggcctgacca tactgacgcc cgaggacatc ccctcgcgca tctggccgtt ggccgcccgc       600
     aagatcaatg gcatcggccc gaaagcgagc gagcggctgg ccacgctcgg catcaacacg       660
     gtcggcgatc tggcgcacgc cgcgcccgat ctgctgcagt ccaacttcgg cctcaagtac       720
     gcgacgtggc tcacgcatgt cgcgcggggc atcgacgagc gccccgtggt agtcgaatcg       780
     gagccgaagt cgatgagccg cgagacgacc ttcgaacgcg acctgcatcc gcgccatgac       840
     cggcccgcgc tgtcggagtc gttcacgcgg ctatgcgtgc gcgttgccga agacttgcag       900
     cgcaagggct acgtcgggca cacgatcggc atcaagctgc gcttcgacga cttctccacg       960
     gtgacccgcg acctgacgct gcccgtcgcg acatcggatg cgggtgcgat ccggcgcgcg      1020
     gcgaccgaat gtctgaagcg cgtcgcgctg acgcgcaagc tgcggctgct tggcgtgcgc      1080
     gtcagcggtt tgtcgctggc aagcgagcag gcgccgccgc tgccgatcca ggccgaattg      1140
     ccgttcacgg cttga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page