(data stored in ACNUC29543 zone)

EMBL: CP001044.PE220

CP001044.PE220       Location/Qualifiers
FT   CDS_pept        complement(269183..270427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3333"
FT                   /product="sarcosine oxidase, beta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, beta subunit family;
FT                   PFAM: FAD dependent oxidoreductase; KEGG: bvi:Bcep1808_3459
FT                   sarcosine oxidase, beta subunit family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3333"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72489"
FT                   /db_xref="GOA:B2JSB2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSB2"
FT                   /protein_id="ACC72489.1"
FT                   /translation="MSRYSIFSLFRNGLSYHENWERQWRSPEPKKEYDVVIVGGGGHGL
FT                   ATAYYLAKEHGVKNVAILEKGWIGGGNTARNTTIVRSNYLWDESAALYEKAMKLWEGLS
FT                   QDLNYNVMFSQRGVMNLAHTLQDVRDTERRVNANRLNGVDAEFLTPAQIKEIEPTINLN
FT                   SRYPVLGASIQRRAGVARHDAVAWGFARGADQAGVDIIQNCQVTGIRRDGGRVTGVDTV
FT                   KGFIKAKKVAVVAAGNTTTLADMAGIRLPIESHPLQALVSEPIKPVVNSVIMSNAVHAY
FT                   ISQSDKGDLVIGAGVDQYTGFGQRGSFHIIEGTLQAIVEMFPVFSRVRMNRQWGGIVDV
FT                   SPDACPIISKTDVKGLYFNCGWGTGGFKATPGSGWVFAHTIANDEPHPLNAPFSLDRFY
FT                   TGHLIDEHGAAAVAH"
     atgagccgct attcgatatt cagtctgttc cgcaacgggt tgtcgtatca cgagaactgg        60
     gagcgacagt ggagaagccc ggaaccgaag aaggaatacg acgtggtgat cgtcggcggt       120
     ggcgggcacg gtctcgcgac cgcttactac ctcgcgaagg aacacggcgt gaagaacgtc       180
     gcgattctgg aaaaaggctg gatcggtggc ggcaacacgg cgcgcaacac caccatcgtg       240
     cgttcgaact atctgtggga cgaatccgcg gcgctctatg aaaaggcgat gaagctgtgg       300
     gaaggtctgt cgcaagacct gaactacaac gtgatgttct cgcagcgcgg cgtgatgaac       360
     ctcgcgcaca cgctgcagga cgtgcgcgac actgagcgcc gcgtgaatgc gaaccgcctg       420
     aacggcgtcg atgccgagtt cctcacgccc gcgcagatca aggaaatcga gccgaccatc       480
     aatctgaaca gccgctaccc ggttctcggt gcttccattc aacgccgtgc gggcgtcgcg       540
     cgtcacgatg cggttgcatg gggcttcgcg cgcggcgcgg atcaggcggg cgtcgacatc       600
     atccagaact gccaggtgac gggcatccgc cgcgacggcg gccgtgtaac gggcgtcgat       660
     acggtgaagg gcttcatcaa ggcgaagaag gttgccgtcg tcgccgcggg caacacgacc       720
     acgctcgccg acatggcagg catccgtctg cccatcgaaa gccatccgct gcaggcgctc       780
     gtatccgagc cgatcaagcc cgtcgtcaac tcggtgatca tgtcgaacgc ggtgcacgca       840
     tacatcagcc agtccgacaa gggcgacctc gtgatcggcg cgggcgtcga ccagtacacg       900
     ggcttcggcc agcgcggcag tttccacatc atcgaaggca cgctgcaggc gatcgtcgag       960
     atgtttccgg tgttctcgcg cgtgcgcatg aaccgtcagt ggggcggcat cgtcgatgtg      1020
     tcgcccgatg cgtgcccgat catcagcaag accgacgtca agggcctgta cttcaactgc      1080
     ggctggggca cgggtggctt caaggcgacg ccgggctcgg gctgggtgtt cgcgcacacc      1140
     atcgcgaacg acgaaccgca tccgctcaac gcgccgttct cgctggaccg cttttacacc      1200
     ggtcatctga tcgacgaaca cggcgctgca gccgtggccc actaa                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page