(data stored in ACNUC29543 zone)

EMBL: CP001044.PE224

CP001044.PE224       Location/Qualifiers
FT   CDS_pept        274459..275385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3337"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_A3026 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3337"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72493"
FT                   /db_xref="GOA:B2JKW4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKW4"
FT                   /protein_id="ACC72493.1"
FT                   /translation="MNPTELFALLPDMATFARVVDAGNFSEAARQLGSTPSTVSRQIKR
FT                   LEESLGTRLLERSTRRIRVTDAGAQVYRYCRDIVGAASGAVDVAGQSVGEPRGKVSISA
FT                   PIAFARSVIHPLIPEFLRSWPDVDVQLVFADREVDPLRDDVDIVIRLTRSPPLGLAARR
FT                   LGTVRWLLCASPAYLDAHGTPAEPRDLARHECLYLGETVDDNRWHFRRGTQTQSLEVRG
FT                   RYIANHAGARLDAALQHFGIASLPDFVAAQWLRQGDLVQVLAAWEFEARSYMGPVWLLY
FT                   PPNRFLPSKARALIDYLADHLYVAADE"
     atgaatccca ctgagctttt tgcgctgttg ccggacatgg cgacctttgc ccgcgtggtc        60
     gatgcaggca atttctcgga ggccgcgcgc caactgggca gcacgccgtc gacggtgagc       120
     cggcagatca agcgtctcga agagtcgctt ggcacgcgcc tgctggaacg gtcgacgcgt       180
     cgcatccgcg tgacggatgc gggcgcgcag gtctaccgct attgccgcga catcgtcggc       240
     gcggcgtccg gcgccgtcga cgtcgccggg caatcggtcg gcgagccgcg agggaaggtc       300
     agcatcagtg caccgatcgc cttcgcgcga tctgtgatcc atccgctgat tcccgaattt       360
     ctgcgcagct ggccagacgt ggatgtgcaa ctggtgttcg ccgatcgcga agtcgatccg       420
     ttgcgggacg acgtcgacat tgtgatccga ctgacacgtt cgcctccgtt ggggctcgct       480
     gcccggcgtc tcggcacggt gagatggctg ctctgcgcgt caccggctta tctcgacgca       540
     cacggaacgc ccgccgagcc ccgtgatctc gcccggcatg agtgcctgta tcttggagaa       600
     acggtcgatg acaatcgctg gcatttccgg cgcggcacgc aaacccagtc actcgaagtg       660
     agggggcgtt atatcgccaa ccatgcgggc gcccgtctcg atgcagcgtt gcagcacttc       720
     ggcattgcga gcctgcccga cttcgtcgct gcgcagtggc tgcggcaagg ggacctcgtt       780
     caggttctcg ccgcatggga gttcgaagcg cgttcctata tgggcccggt gtggctgctg       840
     tatccgccta accgcttcct tccgtcgaag gcccgggcgc tgatcgatta cctcgccgat       900
     catttgtacg tagctgcgga cgagtga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page