(data stored in ACNUC29543 zone)

EMBL: CP001044.PE226

CP001044.PE226       Location/Qualifiers
FT   CDS_pept        276225..276464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3340"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72495"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKW6"
FT                   /protein_id="ACC72495.1"
FT                   /translation="MSIRKISANAAAAVGVFLLLSFPISRIVFTDGFNSFLNHTLLMLG
FT                   ITYEREPGDSLVDAFLILSLLSLQPQPCGYATPS"
     atgagcatcc ggaaaatctc tgcaaatgcg gcggccgcag tgggcgtgtt ccttctcctt        60
     tctttcccga tcagccggat cgtctttaca gatggattca attcattttt gaatcacaca       120
     ttgctaatgc ttggcatcac atacgaacga gaaccgggag attcgttagt cgatgcattt       180
     cttatattgt cccttctctc tcttcagccg caaccgtgtg gttatgcaac gccctcataa       240
//

If you have problems or comments...

PBIL Back to PBIL home page