(data stored in ACNUC29543 zone)

EMBL: CP001044.PE227

CP001044.PE227       Location/Qualifiers
FT   CDS_pept        276474..276956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3341"
FT                   /product="protein of unknown function DUF796"
FT                   /note="PFAM: protein of unknown function DUF796; KEGG:
FT                   bxe:Bxe_A2091 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3341"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72496"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKW7"
FT                   /protein_id="ACC72496.1"
FT                   /translation="MEKAQMSNDTFIKIDGIAGESEDVIHSDEIQVTNWGGKMSQQSSM
FT                   LSGSGGGAAKATVEDLVFFHEVDRASPNLMSYCLTGKHIAKVVLTMRKAGGIPLDFLRI
FT                   TISDVVITGVEMSASYEQVRLSFASVRQEYLLQNAQGGSRGVITGTFDLKQNAPGR"
     gtggaaaagg ctcaaatgtc gaatgacact ttcataaaaa tcgatggaat tgcaggcgaa        60
     tcagaagatg tgatccattc cgacgaaatt caggtgacca actggggagg gaaaatgtcc       120
     cagcagtcat ccatgctgtc gggctctggt ggtggcgcag ccaaggccac ggtcgaggac       180
     cttgtatttt tccacgaggt cgaccgggca agtccaaacc tgatgtcata ttgcctgacc       240
     ggaaaacata ttgccaaagt cgtgctgact atgcgtaagg caggtggcat tccgcttgat       300
     ttcctgcgaa ttaccataag tgacgtcgtc ataacaggag tggaaatgtc cgccagctac       360
     gaacaagtcc gcttatcgtt cgcaagcgtc aggcaggagt atctgttgca aaatgctcaa       420
     ggcggaagca gaggtgtcat caccggaaca ttcgatctca agcaaaacgc ccctggccgt       480
     tag                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page