(data stored in ACNUC29543 zone)

EMBL: CP001044.PE229

CP001044.PE229       Location/Qualifiers
FT   CDS_pept        complement(278728..279645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3343"
FT                   /product="ornithine cyclodeaminase/mu-crystallin"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   bxe:Bxe_B1765 ornithine cyclodeaminase/Mu-crystallin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3343"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72498"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKW9"
FT                   /protein_id="ACC72498.1"
FT                   /translation="MSTTPIFDAAGTARLIPFRPLVDALKTAAADYAAGRVASPERLVV
FT                   PLNDNGIMLSMPASAADLAIHKLVNVCPRNGERALPTIHGQVMTFDPDTGKTLFILDGP
FT                   TVTGRRTAAMTMLGIETLVHAAPKDILLIGAGTQAASHVQAIGELYPQARVRVRGTSPA
FT                   RAQAFCDAHQGNVRALEPLSDSTIPDSVDTVIALTTSRQAVYDETPRAGRIVIGVGAFT
FT                   PQMCEIGARTLAGSALYVDDLAGAKHEAGDFIQAGINWSTVTGINDALANRPAANLPIV
FT                   FKTVGCAAWDLAAGRVARAALSAG"
     atgagcacca caccgatttt cgacgccgcc ggcacggcgc gcctgattcc gtttcgcccg        60
     ctcgtcgatg cactgaagac agcggccgcc gactatgcag cgggacgcgt cgcgagcccc       120
     gagcggctcg tcgtgccgct gaacgacaac ggcatcatgc tgtcgatgcc cgcctcggca       180
     gcggatcttg cgatccacaa gctcgtcaac gtctgcccgc gcaacggcga gcgcgcgctg       240
     cccacgattc acggtcaggt aatgacgttc gatccggaca cgggtaagac gctgttcatt       300
     ctcgacggtc cgaccgtcac gggacgccgc acggccgcga tgacgatgct cggcatcgaa       360
     acgctggtgc acgcggcgcc gaaagacatt ctgctgatcg gcgcgggcac gcaggcggcg       420
     agccatgtgc aggcgatcgg cgaactgtat ccgcaggcgc gcgtgcgtgt gcgcggcacg       480
     tcgccggcac gcgcgcaggc attctgcgac gcgcaccagg gcaatgtgcg cgcgctcgag       540
     ccattgagtg attcgacgat ccccgattcc gtcgataccg tcatcgcgct gacgacgagc       600
     cgccaggccg tctacgacga aacgccacgc gcgggccgta tcgtgattgg cgtcggcgcg       660
     ttcacgccgc agatgtgcga gatcggcgcg cgtacgcttg cgggcagcgc gctctatgtc       720
     gacgatctgg cgggcgcgaa gcacgaagcg ggcgatttca tccaggcggg catcaactgg       780
     tcgacggtga cgggcatcaa cgatgcgctt gcgaaccggc cggccgccaa tctgcccatc       840
     gtcttcaaga cagtcggctg cgcggcgtgg gacctggcgg cggggcgggt cgcgcgtgcg       900
     gcgttgagtg cgggctga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page