(data stored in ACNUC29543 zone)

EMBL: CP001044.PE23

CP001044.PE23        Location/Qualifiers
FT   CDS_pept        complement(19271..19576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpm:BURPS1710b_A2282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3124"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72292"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR66"
FT                   /protein_id="ACC72292.1"
FT                   /translation="MKAGRLWVGLAALVLTSAAHAEKYVEIWNPPEARGHAAGATAQKP
FT                   VRPHAQKPASPRLARKVTEPGNRPAVQGASSVVSTKRPGNRSIPRKIGPDGNVFRV"
     atgaaagcag gtcgtctgtg ggtcggactc gccgcgctgg ttttgacttc cgcggcacac        60
     gcggaaaagt acgtcgagat ctggaatccc cctgaagcac gcggccatgc ggcgggggcg       120
     acggcgcaaa agccagttcg tccgcatgcc caaaaacccg cttcgccgcg gcttgcgagg       180
     aaagtgaccg aaccgggcaa taggccggct gttcagggcg cgtcgtcggt ggtgtcgacc       240
     aagcggcccg gcaaccggag cattccgcgc aaaatcggtc ccgatggcaa cgtgtttcgc       300
     gtgtga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page