(data stored in ACNUC29543 zone)

EMBL: CP001044.PE232

CP001044.PE232       Location/Qualifiers
FT   CDS_pept        complement(281446..282786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3346"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bxe:Bxe_B1769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3346"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72501"
FT                   /db_xref="GOA:B2JKX2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX2"
FT                   /protein_id="ACC72501.1"
FT                   /translation="MTTTYPLHAHLSPADTPFPDKADVVIAGAGIMGCAAAYYLARRGV
FT                   KAVVLDKSRIAGQQSTRAWGFVRQQGREAAEVPLMMAGMRIWEQLERELDFDLEWRQGG
FT                   CLYVADNDADWASFQQWLDVAKQYGLDTRVLDRAQIDQHVRGMQGNALGGLYTPSDGQA
FT                   EPRRAAAAFAARAVEAGAQFFEGCGVVGIERAAGAVTAVVTERGAIRTRRVICAAGASS
FT                   WRLLATLGIALPQQAVRGTCMRTNPLPAITASTFWGHGLGIRQRANGAINLADDMQVDV
FT                   DMTFGHLRALKWFLPELWAQREKFSFHLNGAFVRDLCDRLPGVVPAGERVLHPRDPNPQ
FT                   PNRGHAPRALQKLRALFPALKDARIVESWAGLIDVLPDGIPVLDAPSQMSGLLIATGFC
FT                   GHGFAMGPIAGRLMAEWIDEGQPSMDLSAFRLQRFFDGTMQRPRSML"
     atgacgacca cctatccgct gcacgcccat ctgagtccgg ccgacacgcc gtttcccgat        60
     aaagccgacg tcgtcatcgc gggcgcaggc atcatgggct gcgcggcggc gtactatctt       120
     gcgcgccgcg gcgtgaaggc agtcgtgctc gacaagtcgc gcatcgcggg acagcagtcg       180
     acgcgcgcct ggggtttcgt gcgtcagcag ggccgcgaag ccgccgaggt gccgctgatg       240
     atggcaggca tgcgcatatg ggaacagctc gaacgcgagc tggatttcga tctcgaatgg       300
     cggcagggcg gctgtctcta cgtcgcggac aacgacgcag actgggcgtc gttccagcaa       360
     tggctcgatg tcgcgaagca atatggactg gacacgcgcg tgctcgatcg tgcgcagatc       420
     gaccagcatg tgcgcggcat gcagggcaac gcgctgggcg gcctgtacac gccgagcgac       480
     ggccaggccg aaccgcgccg tgcggcggct gcgttcgcgg cgcgcgccgt cgaagcgggt       540
     gcgcagttct tcgaaggctg tggcgtggtg ggcatcgaac gggcggcagg cgcggtgacg       600
     gccgtcgtga ccgagcgcgg cgcgatccgc acgcggcgag tgatctgtgc ggcgggcgcg       660
     agcagctggc ggctgctcgc tacgctcggc atcgcgttgc cgcagcaggc ggtgcgcggc       720
     acctgcatgc gcacgaatcc gctgccggcg atcacggcat cgacgttctg gggccacggc       780
     ctcggcatcc gccagcgcgc gaacggcgcg atcaatctcg ccgacgacat gcaggtcgat       840
     gtcgacatga cgtttggcca cctccgtgcg ctgaagtggt tcttgcccga gctgtgggcg       900
     cagcgcgaga agttcagttt ccatctgaac ggcgcgttcg tgcgcgacct gtgcgaccgc       960
     ctgccgggcg tcgtgcctgc gggcgagcgc gttctgcatc cgcgcgaccc gaatccgcag      1020
     cccaatcgcg gtcatgcgcc gcgcgcattg cagaagttgc gcgcgctgtt tccggcgctc      1080
     aaggacgccc ggatcgtcga gtcgtgggcc gggttgatcg atgtgctgcc cgacgggatt      1140
     cccgtgctcg acgcgccatc gcagatgtcc ggtttgctca tcgccacggg tttctgcgga      1200
     catggcttcg cgatggggcc gatcgccggg cgcctgatgg ccgagtggat cgacgaaggt      1260
     cagccgtcga tggatctttc cgcgttccgg ttgcagcgct ttttcgacgg cacgatgcag      1320
     cggccgcgga gcatgctatg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page