(data stored in ACNUC29543 zone)

EMBL: CP001044.PE233

CP001044.PE233       Location/Qualifiers
FT   CDS_pept        283241..284095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3347"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; BetR domain
FT                   protein; KEGG: bxe:Bxe_B1770 response regulator receiver
FT                   domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3347"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72502"
FT                   /db_xref="GOA:B2JKX3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013975"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX3"
FT                   /protein_id="ACC72502.1"
FT                   /translation="MSNEATSPDSLAVAERVRELMSRHGIGKRQQTSELCRILDLSFSQ
FT                   GHRKLRGNSPWTLSQIKKVAEVFGEPAAQLFGAQSLDPGMVGATAQEAVFAIGSIELAC
FT                   TAWIGAPIEAGSRPEFIAWSKHDQWRVVRYDGALYQNAYEVHKIEIYPRRAETDKPLIA
FT                   VVDDDQASADNLRDYLERSGFAAVAIYGLTAFAETLQTQVFDGVVIDWLFGPQTSAEAI
FT                   RTVRASENPDAPIFVLTGELLTGKASESEISDIVRNYDVACYEKPARMAILVADLSKRL
FT                   SRA"
     atgtccaacg aagccacctc acccgactcg ctagccgtcg ccgaacgcgt gcgcgagttg        60
     atgagccgtc acggcatcgg caagcgtcag caaaccagcg agctttgccg gatcctcgat       120
     ttgagttttt cgcagggcca ccggaagctg cgcggcaaca gcccgtggac gctctcgcag       180
     atcaagaagg tcgccgaggt attcggtgag ccggctgccc agttgttcgg cgcgcagtcg       240
     ctcgatccgg gcatggtggg cgccaccgcg caggaagccg tgttcgcaat cggctcgatc       300
     gaactggcgt gcaccgcgtg gataggtgcg ccgatcgaag caggcagccg gccggagttc       360
     atcgcgtggt cgaagcacga ccagtggcgc gtggtacgtt acgacggcgc gctctatcag       420
     aacgcgtacg aagtccacaa gatcgagatc tatccgcgcc gcgccgagac tgacaagccg       480
     ttgatcgccg tggtcgacga cgatcaggcg tccgccgaca acctgcgcga ctatctcgaa       540
     cgcagcggct tcgcggctgt cgcgatctac gggctgaccg ctttcgcgga aacgctgcag       600
     acgcaggtgt tcgacggcgt cgtgatcgac tggctcttcg gcccgcagac atcggcggaa       660
     gcgattcgca cggtgcgcgc gtcggagaac ccggacgccc ccattttcgt gctgacgggc       720
     gaactgctga cgggtaaggc gagcgagtcc gagatcagcg acatcgtgcg caactatgat       780
     gtcgcgtgct acgagaaacc ggcacgcatg gcgattctcg tcgccgatct gtcgaaacgg       840
     ttgagccgcg cataa                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page