(data stored in ACNUC29543 zone)

EMBL: CP001044.PE234

CP001044.PE234       Location/Qualifiers
FT   CDS_pept        complement(284134..285960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3348"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: bxe:Bxe_B1771 periplasmic sensor hybrid
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3348"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72503"
FT                   /db_xref="GOA:B2JKX4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX4"
FT                   /protein_id="ACC72503.1"
FT                   /translation="MTRRPLRRVVLVVIWIAALAAPTAAISYLLYSTLLNPRATQQLTG
FT                   TYDGFYWDAAQLQIAYARLESQLLLYETGVDSDYPRLALHFQVLQSKLHVMAGSTQRLA
FT                   AQAEAVQRQQQEIAGLSAMLVALQPSLDALPNSPALASQMVEELRKHWKEVNDLALSRR
FT                   NVDLQGREAMNSDFIAKRRMLFAGGLVLLLLSAAATALLVMNGRRRTKLILQQHAALDA
FT                   EHQASRAAREASLAKDAFLGMISHELRTPLHAIVSSIELLGMTFHSEADRKVLHRLETA
FT                   ARHLEAQMKDLTDYARLGAGKLELRNEHFDPRELLVSIVDENEPAARAKGLTFEGVASG
FT                   RVGLVDSDPHRIRQIVNNLVTNGIRYTERGMVTLRFEQRDDALAVVVADTGAGVPDKQI
FT                   PLIFKEFTQLDSSRTRRFEGAGMGLAIVQGLVDLFGGTISVDSEVGKGTRFTVTIPVKP
FT                   VAAPAGVSAAPQAAHGEWRPQVLIVDDNQLMRESLCEMLAHMGCDAAAVANADDAHAWL
FT                   AARRCDLVLLDLHMPDKDGYAFMAEYQENVSGQPADTRTPVIAVSAYAPDGAARAEADL
FT                   FFDSLTKPVHYEVLRAAVQRALAARHGASVAG"
     atgacacggc gcccgctgcg ccgggtcgtg ctcgtcgtca tctggatcgc tgcgctcgct        60
     gcgccgactg cggcgatcag ttacctgctc tactcgacgc tgctcaatcc gcgcgcaacc       120
     cagcagctga caggcaccta tgacggcttc tactgggacg ccgcgcagtt gcagatcgcg       180
     tacgcgcgcc tcgaaagcca gttgctgctg tacgagacgg gcgtcgacag cgactatccg       240
     cggctcgcgc tgcacttcca ggtattgcag tcgaaactgc acgtgatggc gggctcgacg       300
     cagcgcctcg ccgcccaggc ggaagccgtg cagcgccagc agcaggaaat cgccgggctg       360
     tcggcgatgc tcgtcgcgct gcagccgtcg ctcgacgcgc tgccgaactc gcccgcgctc       420
     gcctcgcaga tggtcgagga actgcgcaag cactggaagg aagtcaacga tctcgcactg       480
     agccgccgca acgtcgatct gcagggccgc gaggcaatga actccgactt catcgcgaag       540
     cggcggatgc tatttgcggg cgggctggtg ctgctattgc tgtcggcggc ggcgactgcg       600
     ctgctggtga tgaacggccg gcgccgcacg aagctgattc tccagcagca cgccgcgctc       660
     gacgccgagc atcaggcgag ccgcgccgcg cgcgaggcga gtctcgcgaa ggatgcgttc       720
     ctcggcatga tcagccatga gttgcgcaca ccgctgcacg cgatcgtttc atcgatcgaa       780
     ctgcttggca tgacgtttca ttccgaggcg gaccgcaagg tgctgcaccg gctggagacg       840
     gccgcgcgcc atctcgaagc gcagatgaag gatctgaccg actatgcgcg ccttggcgcc       900
     ggcaagctcg aattgcgcaa tgagcatttc gatccgcgcg agctgctggt gtcgatcgtc       960
     gacgaaaacg agccggctgc gcgcgccaag gggctcacgt tcgaaggcgt cgcgagcggg      1020
     cgagtcgggc tcgtggattc cgatccgcat cgcatccgtc agatcgtcaa caacctcgtg      1080
     accaacggca tccgctatac ggagcgcggc atggtcacgc tgcgtttcga acagcgcgac      1140
     gacgcgctgg ccgtggtcgt ggccgacaca ggcgcaggcg tgccggacaa gcagattccg      1200
     ctgatcttca aggagttcac gcaactggac tcgtcgcgca cgcgccgctt cgagggcgcg      1260
     ggcatggggc tcgcgatcgt gcaaggactc gtcgatctgt tcggcgggac gatcagcgtc      1320
     gacagcgagg tgggcaaggg cacgcgcttc acggtgacga tccccgtgaa gccggtcgcc      1380
     gcgcctgcgg gcgtgtcggc tgcgccgcaa gcggcgcatg gcgagtggcg cccgcaggtg      1440
     ctgatcgtcg acgacaacca gctcatgcgc gagtcgctgt gcgaaatgct cgcgcacatg      1500
     ggctgcgacg cggcggccgt cgccaatgcc gacgacgcgc acgcatggct cgctgcgcgg      1560
     cgctgcgatc tggtgctgct cgatttgcac atgccggaca aggacggcta cgcgttcatg      1620
     gccgagtatc aggagaacgt gagcgggcag ccggccgaca cgcggacgcc cgtgatcgcg      1680
     gtgagcgcct atgcgcccga cggcgcggcg cgtgccgagg ccgatctgtt cttcgacagc      1740
     ctgacgaagc cggttcacta cgaggtgttg cgcgccgccg tgcagcgcgc gctggcggcg      1800
     cgccacgggg cgtcggtggc gggctga                                          1827
//

If you have problems or comments...

PBIL Back to PBIL home page