(data stored in ACNUC29543 zone)

EMBL: CP001044.PE236

CP001044.PE236       Location/Qualifiers
FT   CDS_pept        286677..287624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3350"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: bxe:Bxe_B1773
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3350"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72505"
FT                   /db_xref="GOA:B2JKX6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX6"
FT                   /protein_id="ACC72505.1"
FT                   /translation="MKKPVLPLTYEQLDHWIDSLQPALLEERFAAAVGILRGGAPLALM
FT                   ASHAVGVPVAFLSYDRRARHVTWDSAQPLPPPGSKVLLCEDIAGRGFTLVDCIAFLEQH
FT                   GLIVKTLTGAFDEISRIRPDYANDASGFFALFPWERQAYTDDYREDWLKVESGSAAKMA
FT                   EDHEYATYAIDLDGILLPDVPLSRYDEDLAAALNERDALLPFDVLPHVDLQKVRAVITG
FT                   RPHADLTRTRAWLERHGFGHLELVMRMPDSHDETPEGAAAHKAAAALRCGVTHFVESDP
FT                   VQALYIAKLAPLLRVIWWDAAKHKGTLIAASAWR"
     atgaaaaagc cggttttacc gctgacctac gaacagctcg accactggat tgactcgctg        60
     cagcccgccc tgctcgaaga gcgctttgcc gccgccgtcg gcattttacg gggcggtgcg       120
     ccgctggcgt tgatggcatc gcacgccgtc ggcgtgcccg tcgcgtttct cagctacgac       180
     cgccgcgcgc gccatgtcac gtgggattcg gcacagcctc tgcccccacc cggctcgaag       240
     gtgctgctgt gcgaggacat tgcgggacgc ggcttcacac tggtcgactg catcgcgttt       300
     ctcgagcagc acggcctgat cgtcaagacg ctgacgggcg cattcgacga aatcagccgc       360
     atccgcccgg actacgccaa cgacgcttcg ggctttttcg cgctgttccc gtgggagcgc       420
     caggcctaca cggacgacta tcgcgaagac tggctgaagg tcgagtccgg ttcggccgcg       480
     aaaatggcgg aggaccacga atacgccacc tacgcgatcg acctggacgg catcctgctg       540
     cccgacgtgc cgctgtcacg atatgacgaa gacctcgccg ccgctttgaa cgagcgcgat       600
     gcgctgctgc cgttcgacgt gctgccccac gtcgatttgc agaaagtgcg cgcggtgatc       660
     acgggccggc cacacgccga cctgacgcgc acgcgcgcgt ggctggagcg gcacggcttc       720
     ggccatctgg aactcgtgat gcgcatgccc gacagccacg acgaaacgcc cgaaggcgcc       780
     gccgcgcaca aggcggccgc ggcgcttcgt tgcggtgtca cgcatttcgt cgagagcgat       840
     cccgtgcagg cgctgtatat cgcgaaactt gcgccgctgt tgcgcgtgat ctggtgggac       900
     gcggcgaagc acaagggcac gctgatcgcc gcgtcggcct ggcgctga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page