(data stored in ACNUC29543 zone)

EMBL: CP001044.PE238

CP001044.PE238       Location/Qualifiers
FT   CDS_pept        289532..290158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3352"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bxe:Bxe_B1775 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3352"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72507"
FT                   /db_xref="GOA:B2JKX8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX8"
FT                   /protein_id="ACC72507.1"
FT                   /translation="MITVWGRANSVNVQKVLWVCDELVLPYHRIDAGLQFGRNDEPRYL
FT                   AMNPTGKVPTLVDGDYVLWESNSILRYLVMQYGASSLLYPEEAKTRASIDRWLDWALST
FT                   LQPAERPVFWAIVRTPAEQRDNAKLAADIDNVSKLWQMLDAQLQGRFFMEGENFTLADV
FT                   VLGAYAKRWFGLPGVERPSLPNLERWYLRLATRSGFKRYVDFDLT"
     atgattacag tgtggggacg cgcaaactcg gtcaatgtgc agaaagttct gtgggtatgt        60
     gacgaactgg tcttacccta tcaccgcatc gacgccggcc tgcagttcgg ccgcaacgac       120
     gagccccgat atctcgcgat gaacccgaca ggcaaggtgc cgacgctcgt cgacggcgac       180
     tatgtgctgt gggaatcgaa ctcgattctg cgctatctgg tgatgcagta cggcgcatcc       240
     agcctgctgt accccgagga agccaaaacg cgtgcgagca tcgatcgctg gctcgactgg       300
     gcgctgtcca cgctgcagcc cgccgagcgc ccagtgttct gggccatcgt gcgtacgccg       360
     gcggagcaac gcgacaacgc gaagctcgcc gccgacatcg acaatgtctc gaagctgtgg       420
     cagatgctcg acgcgcaact gcaagggcgc ttcttcatgg aaggcgaaaa cttcacgctc       480
     gcggatgtcg tgctgggcgc gtatgcgaag cgctggttcg ggctgccggg cgtcgaacgt       540
     ccgtcactgc cgaatctcga acgctggtat ctgcggctcg ccacccgctc cggcttcaag       600
     cgatacgtcg acttcgatct gacctga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page