(data stored in ACNUC29543 zone)

EMBL: CP001044.PE241

CP001044.PE241       Location/Qualifiers
FT   CDS_pept        complement(291489..291965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3355"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bxe:Bxe_B1777 response regulator receiver domain
FT                   protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3355"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72510"
FT                   /db_xref="GOA:B2JKY1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY1"
FT                   /protein_id="ACC72510.1"
FT                   /translation="MRYIMATSECITRFSSHNIKMNGVLRLDQATIVLVEDDPQNRESL
FT                   KILLESEGANVIAVADAEEGVEAAVRALPDAVVCDLDLPAMDGFYLIQRVRDHEIRGDH
FT                   SPSVAVALTGHTDEAYRLRSIGEGFQHFMTKPAPPEALVTLLHDAIGARAAGLT"
     atgcgttaca tcatggccac gtcagaatgc ataaccagat tttccagcca taacatcaag        60
     atgaacggag tactgaggct cgatcaggcc acgatcgtgc tcgttgaaga cgacccgcaa       120
     aatagggaat cattgaagat tctgctcgaa tcggaagggg cgaacgttat cgccgtggcg       180
     gacgcggaag agggcgttga agcggcagtg cgggcattgc ccgatgccgt cgtctgcgat       240
     ctcgatctgc ccgcgatgga cggcttctat ctgattcaac gcgtgcggga tcacgagatt       300
     cgcggcgatc attccccttc ggtcgcagtg gctctcacgg gccataccga cgaagcctac       360
     cggctgcgca gcatcggcga aggtttccag catttcatga cgaaaccggc gccgcctgag       420
     gcgctggtga cgttactgca tgacgcgatt ggcgcacgcg cggccgggtt gacctga          477
//

If you have problems or comments...

PBIL Back to PBIL home page