(data stored in ACNUC29543 zone)

EMBL: CP001044.PE242

CP001044.PE242       Location/Qualifiers
FT   CDS_pept        complement(292338..293081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3356"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B1778
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3356"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72511"
FT                   /db_xref="GOA:B2JKY2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY2"
FT                   /protein_id="ACC72511.1"
FT                   /translation="MARQAQTGSKAGSKAGSDRTDQPGGVEEAGARARPEPAARRPGRP
FT                   SGSGRGPEQRARLLDAALALFARQGIVDTTLGQVAREAGFTPAMMHYYFKTRDQLLDVL
FT                   IDERFLPLRARLGGSFQAHPDDPVAAITLLAQRLVEVAGHYPWFPPLWIREVISEGGLL
FT                   KLRMHERFGDANQKNGIAYIEKWQRDGKINAALEPSLVFLSVIGLTILPLATSSMWRND
FT                   PARRKLTADDIARHAVALLTQGVAR"
     atggcaaggc aagcacaaac gggatcgaaa gcgggatcga aagcgggttc ggatcgaacg        60
     gatcagcctg gcggcgttga agaggcaggc gcgcgagcgc gcccggagcc cgccgcgcgc       120
     cgacccggcc gcccatccgg cagcgggcgc ggtccggagc agcgagcgcg cctactggac       180
     gcagcgctcg cgctgttcgc gcggcagggt atcgtcgata cgacgctcgg gcaggtcgcc       240
     cgcgaggccg gcttcacgcc cgcgatgatg cattactact tcaagacgcg cgaccagctg       300
     ctcgatgtgc tgatcgacga gcgcttcctg ccgctgcgcg cgcgccttgg cggctcgttt       360
     caggcgcacc ccgacgaccc cgtcgcggcc atcacgctgc tcgcgcagcg tctggtcgaa       420
     gtcgcgggcc actatccgtg gtttcctcca ctgtggatcc gcgaggtcat cagcgaaggc       480
     ggcctgctca agctgcgcat gcacgagcgt ttcggcgacg caaaccagaa gaatggcatt       540
     gcgtacatcg agaaatggca aagggacggc aaaatcaacg cggcgctgga gccgtcgctg       600
     gtatttctgt ctgtgatagg tctgacgatc ttgccgctcg cgacttcgtc gatgtggcgc       660
     aacgaccccg cgcgccgcaa gctgacggcc gacgatatcg cacgtcacgc ggttgcgctg       720
     ctgacgcagg gcgtcgcaag atga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page