(data stored in ACNUC29543 zone)

EMBL: CP001044.PE245

CP001044.PE245       Location/Qualifiers
FT   CDS_pept        296356..297456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3359"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: bxe:Bxe_B1781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3359"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72514"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY5"
FT                   /protein_id="ACC72514.1"
FT                   /translation="MLKTILTGLTGVLSLLIASLAVAAGVSAHYKIVTGQERGTYIQIG
FT                   ADLAKYVAQPAGIDLEVMPSKGSAENVQRMRFEPGVKLALVQSDVYQAYLDMANSGNAD
FT                   AGTTIRPLRLIMPLYNEEIYFVVRNDSPMTTINEIKDKVISIGPIGSGTAQSATTLYRL
FT                   MFNQAIPEQNVQSLSNEDAIAALVVKKIDVAVIVAGQPAKLFTDMNPDLLSQIRILRVD
FT                   PGAAETTRAKETYFPATIRQSSYPNWLKEDVPTLTVKAFLVTYDYGLRDTVSNLNRFAD
FT                   SLCENFDVLQEKGHPKWKQVKLELPPLTKGWQYYPPIERHLRSCIARRASMPAGGTSAS
FT                   VQQQPAAPKTKRPCSDQERLLLLCGK"
     atgctcaaga caatactgac gggattgacg ggagtgctga gcttattgat cgcgtcgctg        60
     gccgtggcag cgggagtcag cgcgcactac aagatcgtga cggggcagga gcgcggaacc       120
     tacatccaga tcggcgcgga cctcgcgaaa tacgtcgcgc agccggccgg catcgacctc       180
     gaagtgatgc cttcgaaggg ttccgcagag aacgtgcagc gcatgcgctt cgagccgggc       240
     gtgaagctcg cgcttgtgca atcggatgtg taccaggcgt atctcgacat ggcgaattcg       300
     ggcaacgccg acgcgggaac gacaatccgc ccgctgcggc tcatcatgcc gctctacaac       360
     gaagagatct atttcgtcgt gcgcaacgac tcgccgatga cgacgatcaa cgagatcaag       420
     gacaaggtca tcagcatcgg gccgatcggc agcggcaccg cgcagtcggc aaccacgctc       480
     taccgcctga tgttcaatca ggcgattccc gagcagaacg tgcagagcct gtcgaacgaa       540
     gacgcgattg ccgcgctcgt cgtgaagaag atcgacgtgg ccgtgatcgt tgcgggtcag       600
     ccggccaagc tcttcaccga catgaatccc gacctgctct cgcagatccg cattctgcgc       660
     gtcgacccgg gtgcggcgga aacgacgcgt gcgaaggaaa cctattttcc cgcgacgatc       720
     cgccagagca gctatccgaa ctggctgaaa gaagacgtgc cgacgctgac cgtgaaggcc       780
     tttctcgtca catacgatta cggtctgcgc gataccgtga gcaatctgaa ccgcttcgcc       840
     gattcgctgt gcgagaactt cgatgtcctt caggagaaag gtcatccgaa gtggaaacag       900
     gtaaaactcg aactgccgcc actcacgaaa ggctggcaat actatccgcc gatcgaacgg       960
     cacctgcgtt cgtgcatcgc gcggcgcgcg tcgatgccgg caggcggtac gtcggcgtcg      1020
     gtgcaacagc agccggccgc gccgaagacg aaacggcctt gctccgatca ggagcgtctg      1080
     cttctgttgt gcggcaagta a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page