(data stored in ACNUC29543 zone)

EMBL: CP001044.PE246

CP001044.PE246       Location/Qualifiers
FT   CDS_pept        complement(297548..299032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3360"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: rme:Rmet_5590 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3360"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72515"
FT                   /db_xref="GOA:B2JKY6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY6"
FT                   /protein_id="ACC72515.1"
FT                   /translation="MKLFDLGGAARRRRSHVGAMLAPVPAAVTVLLAGCTVGPDYKGAP
FT                   ATTHVSSFKRAPDGVVQTAPGVAAWWLALGDPQLTALIDAGIANSPDLRAAQARVRQAR
FT                   AGLSQQQSNELPKVGASAAYLRTREPDLSSLSGGSSSSGGRGPIALYLAGFDASWELDL
FT                   FGGTRRAVEAASAQADASQAELADAHVQLAAEIGSAYVGLRDQQQSMAIVRKSAELEAR
FT                   VLTLTEQRRDRGVASQLDVERVRTQVENTRNALIPLDAQIAESLDELAVLTGREPGALD
FT                   DELNASAPLPALPQTIAVGDPAQLLRRRPDVRAAERRLASQSAQIGEREADWFPKVTLF
FT                   GSLAFSAADPGHLVRKNNFTWLAVPYLQWNAFDFGRTKARVDQSRAALDEAQAKYESTV
FT                   LGALRDADVALSRYGHERENVVSLRTVESSATRAATLTEQRYRAGTATALDWLDAERTR
FT                   YTAEQNRIQSDAQLIKDYVALQKSLGLGWEGMVSTQ"
     atgaagctat ttgatctggg cggcgccgcg cgccgccgtc gttcgcatgt tggcgcgatg        60
     cttgcgcccg tcccggctgc cgtgaccgtg ctgcttgcag gctgcacggt gggtcccgac       120
     tacaagggcg cgcccgccac gacgcacgtg agcagcttca agcgtgcgcc ggacggcgtg       180
     gtgcagacgg cgcccggcgt cgcggcatgg tggctcgcgc tcggcgatcc gcaactgacg       240
     gcgctgatcg acgcgggcat cgccaacagc cccgatctgc gtgccgcgca ggcgcgcgtg       300
     cggcaggcgc gcgcgggctt gtcccagcag cagagcaacg agctgccgaa ggtcggcgcg       360
     agcgcggcgt atctgcgcac gcgcgaacct gatctgtcgt cgctgagcgg cggttccagc       420
     tcgtcgggcg gacgcggacc cattgcgctg tatctcgcgg ggttcgacgc gagctgggaa       480
     ctcgatttgt tcggcggcac gcgccgtgcg gtcgaagcgg cctcggcgca agcagatgcg       540
     tcgcaggcag aactcgccga cgcgcacgtg cagctcgccg cggaaatcgg cagcgcttat       600
     gtgggcttgc gcgatcagca gcagagcatg gcgatcgtgc gcaagtcggc ggaactcgaa       660
     gcgcgcgtgc tgacgctgac cgagcagcgg cgcgatcgcg gcgtcgcgtc gcaactggat       720
     gtggaacgcg tgcgcacgca ggtcgaaaac acgcgcaatg cgctgattcc ccttgacgcg       780
     cagatcgccg aatcgctcga tgaactcgcc gtgctgacag gccgcgagcc gggcgcgctg       840
     gacgacgaac tgaacgcgtc ggcgccactg cccgcgttgc cacagacgat cgccgtgggc       900
     gatcccgcgc aactgctgag gcgacgtccc gatgtgcgcg cagcggagcg gcgactcgcg       960
     tcgcagagcg cgcagatcgg cgagcgcgaa gcggactggt ttcccaaagt gaccctgttc      1020
     ggcagcctgg ccttcagcgc cgccgacccc ggccacctgg tgcgcaagaa taatttcacg      1080
     tggctcgcgg tgccgtatct gcaatggaat gcgttcgact tcggccgcac gaaggcacgt      1140
     gtcgatcaat cgcgtgccgc gctcgacgag gcgcaggcca agtacgaaag cacggtgctc      1200
     ggcgcgctgc gcgatgccga tgtcgcgctt tcgcgctatg gtcatgagcg tgagaacgtc      1260
     gtcagcctgc gcacggtcga gtcgtccgcg acgcgcgcgg cgacgctgac ggaacagcgc      1320
     tatcgcgcgg gcacggcgac ggcgctcgac tggctcgatg cagaacgcac gcgctatacg      1380
     gccgaacaga atcgcatcca gagcgatgcg caactgatca aggactacgt cgcgttgcag      1440
     aagagcctcg ggctcgggtg ggaagggatg gtgtccacgc aatag                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page