(data stored in ACNUC29543 zone)

EMBL: CP001044.PE248

CP001044.PE248       Location/Qualifiers
FT   CDS_pept        complement(300641..301789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3362"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   rme:Rmet_5592 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3362"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72517"
FT                   /db_xref="GOA:B2JKY8"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY8"
FT                   /protein_id="ACC72517.1"
FT                   /translation="MSATLPVEESGRATRAQRSGKKGVFLLIGGVAVLGAIAWGAHWWT
FT                   MGRFIESTDDAYLQADGMTVAPKVSGYVAEVLVGDNQRVTSGQPLVRLDSRQYDAVLEQ
FT                   ANATIAARRADILRGEAELAQQQAAIAQARAQLDGATANEAHAADQVKRYEPLAATGAE
FT                   TNERVADLRNTQRQASATRAADAAALQSAERQIATTHAAIEQSRAQLAAAEASARQAQL
FT                   DAQDTMVKSPIDGRVGDRSVRVGQYAQPGTRFMTIVPVQDVYLVANFKETQIGMMRIGQ
FT                   PVTLRVDALPGAKLHGTIDSFSPGTGSQFALLPAQNATGNFTKIVQRVPVRIKLDVGPE
FT                   TRKVLLPGLSVNVDVDTRSARNNEARIERENEAHVARENNRG"
     atgtcagcca ccttgcctgt tgaggaatcc gggcgcgcca cacgcgcgca acggtccgga        60
     aagaagggcg tttttctcct gattggcggc gtcgccgtgc tcggcgcgat tgcgtggggc       120
     gcgcactggt ggacgatggg ccgcttcatc gaaagcacgg acgacgcgta tctgcaggcc       180
     gacggcatga cagtcgcgcc gaaggtgtcg ggctatgtgg ccgaggtgct ggtcggcgac       240
     aaccagcgcg tgacgagcgg ccagccgctg gtacggctcg acagccgcca gtacgacgcc       300
     gtgctcgaac aggcgaacgc gaccatcgct gcgcgccgcg ccgacattct gcgcggcgaa       360
     gcggaactcg cgcagcagca ggctgccatt gcacaggccc gcgcgcagct cgacggcgcg       420
     accgcgaacg aggcgcatgc cgccgatcag gtcaagcgct acgagccgct tgccgcgacg       480
     ggtgccgaga cgaacgaacg cgtcgccgac ctgcgcaaca cgcagcgcca ggctagtgcg       540
     acgcgcgcag cggacgccgc cgcgctgcaa agcgccgaac gccagatcgc gacgacacat       600
     gctgcgatcg agcagtcgcg tgcgcaactg gccgccgccg aagcgagcgc gcgccaggcg       660
     caactcgacg cgcaggacac gatggtcaag agtccgatcg acggccgcgt cggtgatcgc       720
     agcgtgcgcg tcggtcagta tgcacagccg ggcacgcggt tcatgacgat cgtgcccgtg       780
     caggatgtct atctcgtcgc gaacttcaag gaaacgcaga tcggcatgat gcgtatcggg       840
     caaccggtga cgctgcgcgt cgacgcgttg ccgggcgcga agctgcacgg cacgatcgac       900
     agcttctcgc cgggcacggg ctcgcagttc gcgctgctgc ctgcgcagaa cgcgacgggc       960
     aacttcacga aaattgtgca gcgcgtgccc gtgcggatca agctcgatgt cgggccggaa      1020
     acgcgcaagg tgctgctgcc gggtttgtcg gtgaacgtcg acgtggatac gcgcagcgcg      1080
     cgcaacaacg aagcgcgcat cgaacgcgag aacgaagcgc acgtcgcgcg agagaacaac      1140
     cgtggctga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page