(data stored in ACNUC29543 zone)

EMBL: CP001044.PE249

CP001044.PE249       Location/Qualifiers
FT   CDS_pept        301924..302658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3363"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Transcriptional
FT                   regulator TetR; KEGG: bch:Bcen2424_3902 transcriptional
FT                   regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3363"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72518"
FT                   /db_xref="GOA:B2JKY9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY9"
FT                   /protein_id="ACC72518.1"
FT                   /translation="MITRTPRHRPAAEGGYQRGEETRAKIIEAALGLFGERGFEGASTR
FT                   EIAEHAGVNAPALVYYFDNKEGVYQACVEYIMTSVGAYFADAVAAAQTVLEGKPSDDEL
FT                   IDAFRVIQARVASYLFTTETPATWRLFMAREQAGLGPAFSAERLNERMRKPLLSVSSEI
FT                   VGRLLGRPADDPETIIRLLAINGQLVSFHLTRCTALSALQWKSIDGERLQQLCALIDEQ
FT                   SVILLRAMVDMREANKQRRKKK"
     gtgataacac gcacaccgag acaccgcccc gcagcggaag gcggctatca gcgcggcgaa        60
     gagacccgcg caaagatcat cgaggcggcg ctggggctgt tcggcgagcg cggcttcgaa       120
     ggcgcgtcca cgcgcgagat tgccgagcat gcgggcgtca acgcgcccgc actcgtgtat       180
     tacttcgaca ataaggaagg cgtctatcag gcgtgcgtcg agtacatcat gacgagcgtc       240
     ggcgcctatt tcgcggatgc cgtcgccgcc gcccagacgg tgctggaggg caagccatcc       300
     gacgacgaac tgatcgacgc gttccgcgtg attcaggcac gcgtcgccag ttatctgttc       360
     acgacggaaa cgcccgccac gtggcggcta ttcatggcgc gcgagcaggc gggcctcggt       420
     cccgcattca gcgccgagcg actgaacgag cgcatgcgca agccgctgct gagcgtcagc       480
     tcggaaatcg tcggccggct gctcgggcgg cccgcagacg atcctgaaac gatcatcagg       540
     ctgctggcga tcaacgggca actcgtgtcg tttcacctca cgcgttgcac ggcattgtct       600
     gcgctgcagt ggaaatcgat cgacggcgag cgcctgcagc agctctgcgc attgatcgac       660
     gaacagagcg ttatcctgtt gcgagcgatg gtcgacatgc gcgaagcgaa caagcaacga       720
     cgcaagaaaa agtaa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page