(data stored in ACNUC29543 zone)

EMBL: CP001044.PE25

CP001044.PE25        Location/Qualifiers
FT   CDS_pept        complement(20007..21191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3126"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: rso:RSc1082
FT                   probable porin transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3126"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72294"
FT                   /db_xref="GOA:B2JR68"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR68"
FT                   /protein_id="ACC72294.1"
FT                   /translation="MKTLTCMRMRAVALACLPFAGAVLSTNALAQSSVTLYGVVDNAFS
FT                   YVSNQRGHSNFYMSQGNLQASKFGLLGAEELGGGTKAIFRLESGFNSLTGAQSSAGNIF
FT                   NRQAYVGLSNDRYGTVTLGRQYTPYFNMVGALGPTGVLTGATGAHPGDLDALDTTLRFN
FT                   NSITYASPTIAGFSFGAQYGLGGVPGSVTNGSNFSAALRYDYQSFSVAAGYVKLKDITT
FT                   SQSLGSFAINSPVNNGYASASSTQMVAAAARYNFNDLMVGVNYSNVQYAPGSHSLFASE
FT                   AVFNTYGAIATYRFTPSVIAGIGYSYTRASKANGIDDPAQYHQISLEQTYSLSKRTTFY
FT                   ALEAYQLARGRSLIASGSGTRIADAVAVVGDSQNTTPSSGPSQFVGMVGIRHAF"
     atgaagactt tgacatgcat gcgcatgcgt gcagtggccc tcgcatgcct gccgttcgca        60
     ggtgccgtgc tgtccacgaa cgcgttggcg caaagcagcg ttacgctgta cggcgtcgtc       120
     gacaacgcat tcagctatgt cagcaatcag cgcggccatt cgaacttcta catgagccag       180
     ggcaacctgc aggcgagcaa gttcggtctg ctgggcgcgg aggaactcgg cggcggaacg       240
     aaggcgattt tccggctgga gagcggcttt aactcgctca caggcgcgca aagcagcgcg       300
     ggcaacattt tcaaccgcca ggcttatgtc ggcctgagca acgacaggta cggcacggtg       360
     acgctcggcc gccagtacac gccgtacttc aacatggtcg gcgcgctcgg gccgacgggc       420
     gtgctgacgg gcgcaacagg cgcacacccc ggcgacctcg atgcactgga tacgacgctg       480
     cgcttcaaca actccatcac ctatgcatcg ccgacgatag ccggtttctc gttcggtgcg       540
     cagtacggcc tcggcggcgt gccgggcagt gtgacgaacg gcagcaattt cagcgcggcg       600
     cttcgctacg attatcagtc gttctcggtc gcggccggct atgtgaagct aaaggacatc       660
     acaaccagcc agtcgctcgg cagcttcgcg atcaactcgc ccgtgaacaa cggctacgcc       720
     agcgcgagca gcacgcagat ggtcgccgcc gccgcccgtt acaacttcaa cgacctgatg       780
     gtcggtgtga actactcgaa cgtacagtac gcgccgggtt cgcattcgct gttcgccagc       840
     gaggcggtgt tcaacacgta tggcgcgatc gccacgtatc gcttcacgcc gtccgtgatt       900
     gccggcatcg gctacagcta cacgcgcgcg agcaaggcga acggtatcga cgatccggcg       960
     caataccacc agatttcgct cgagcagacc tacagcctct cgaagcgcac gacgttctac      1020
     gcgctcgagg cgtaccagct ggcgcgcggc aggtcgctga tcgcatcggg ttcgggcacg      1080
     aggatcgccg acgcagtggc cgtcgtcggc gattcgcaga acacgacgcc gtcgtcgggg      1140
     ccgtcgcagt tcgtcggcat ggtggggatt cgtcacgcgt tctga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page