(data stored in ACNUC29543 zone)

EMBL: CP001044.PE251

CP001044.PE251       Location/Qualifiers
FT   CDS_pept        complement(304566..305120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3366"
FT                   /product="protein of unknown function DUF1089"
FT                   /note="PFAM: protein of unknown function DUF1089; KEGG:
FT                   bxe:Bxe_B1793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3366"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72520"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ1"
FT                   /protein_id="ACC72520.1"
FT                   /translation="MREVRWTPQESEGVEHLAFDARADGFYIESVLVGERDGRAYGLMY
FT                   RVKCDLQWRTLRASLKLVGGAELELHGDGEGNWHDGHGLVLASLAGCIDIDISATPFTN
FT                   TLPVRRLQLAKGAREPIAVAFISVPDLQVSRVEQAYTCIEPGSEYRYEGIDTGFAAELK
FT                   VDGDGLVIDYPTMFTRTLPLV"
     atgcgtgaag tgcgatggac cccgcaagag agcgaaggcg tcgagcatct cgcgttcgac        60
     gcgcgcgccg acggtttcta catcgagagc gtgctggtcg gcgagcgcga tggccgcgcg       120
     tacggcctca tgtaccgcgt gaaatgcgat ttgcaatggc gcacgctgcg tgcgtcgctg       180
     aagctggtcg gcggcgcgga gctcgagttg catggcgacg gcgaaggcaa ctggcacgat       240
     gggcatgggc tcgtgctcgc atcgctggcc ggttgcatcg atatcgacat ttcggccacg       300
     ccattcacga atacgctgcc tgttcgccgc ctgcaactcg cgaaaggtgc gcgcgagccg       360
     atcgccgtcg cgttcatttc ggtcccggat ctgcaggtct cgcgcgtcga gcaggcttat       420
     acatgcatcg agccgggcag cgaataccgt tacgaaggca tcgacacagg cttcgcggcg       480
     gagctgaaag tggacgggga tggactcgtc atcgactatc cgacgatgtt cacgcgcacg       540
     ctgccgctag tctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page