(data stored in ACNUC29543 zone)

EMBL: CP001044.PE254

CP001044.PE254       Location/Qualifiers
FT   CDS_pept        307201..307386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3369"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   bam:Bamb_4075 4-oxalocrotonate tautomerase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3369"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72523"
FT                   /db_xref="GOA:B2JKZ4"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ4"
FT                   /protein_id="ACC72523.1"
FT                   /translation="MPTFRIELFEGRTVEQKRQFVEAITKATCESLNVEPGSVDIILVD
FT                   VKKENWATGGRLWSDA"
     atgccgactt ttcgtatcga acttttcgaa ggccgtaccg tagagcagaa gcgccagttc        60
     gtcgaggcga ttaccaaggc aacctgcgag tcgctgaacg tcgaacccgg ttcggtggat       120
     atcattctcg tcgacgtgaa gaaggagaac tgggcaacgg gcggtcgact ttggtctgat       180
     gcttag                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page