(data stored in ACNUC29543 zone)

EMBL: CP001044.PE255

CP001044.PE255       Location/Qualifiers
FT   CDS_pept        307971..308936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3370"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72524"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ5"
FT                   /protein_id="ACC72524.1"
FT                   /translation="MRDQLIASIATRIADYRRGEIAAPTPEHVERWVNQFPNQQDEILA
FT                   ELDHVLGRTYITETSFRAWIAHFVADANILGPAPADFWAGAQLLANQGGGGSQRHLIQV
FT                   IRETINATFGQLQPRAQVATYVYVDDVSYSGNRILNDIGNWINVAPANASLLIFTIGAH
FT                   AYGKWRVERDLGDAVRASGKNITIRWYSYVTLEDRRAHTDVSDVLRPVQVAGDQTVANY
FT                   VQTFARPVVWRLGTSVGVGELFSSGNARSILEQQLLHAGIRIKNMCQFFGKNHRPLGYT
FT                   NLETLGFGSTIVTYRNCPNNAPLALWAGAPWYPLFPRRIN"
     atgagagacc aactgatagc atccatcgcc acgaggatcg ccgactatcg ccgcggcgaa        60
     atcgcggcac cgacgcctga acacgtcgag agatgggtta atcaattccc gaaccagcag       120
     gacgaaatcc tcgccgaact agaccacgtt ctgggtcgaa catacatcac ggagacgtcg       180
     tttcgagcct ggatagcaca ttttgtcgca gacgctaata tcctcgggcc agcgcccgca       240
     gatttctggg ctggagcgca attgcttgct aatcaaggcg gcggcggcag ccagcggcac       300
     ttgattcaag tcatccgcga aacgatcaac gctactttcg gacagttgca accgcgcgcg       360
     caggtagcga catacgtcta cgttgacgac gtgtcctatt ccgggaaccg cattttgaac       420
     gatatcggca actggattaa cgtcgctccg gctaatgcat cactcttgat tttcaccatc       480
     ggggcacacg cgtacggaaa gtggcgagtt gaacgagacc tgggtgacgc cgtgcgtgca       540
     tcgggaaaaa acatcacgat tcgctggtac agctatgtga cgttggaaga ccgacgcgct       600
     catactgacg tcagcgacgt actccgcccg gtccaagtcg cgggagacca gacggttgcg       660
     aattacgtcc aaacctttgc ccgccctgtg gtgtggcggc tcggtacgag tgtcggcgtg       720
     ggtgaactct tctcttctgg aaatgcgcgc tctatccttg agcaacagtt attgcacgct       780
     ggtatccgga tcaagaatat gtgtcaattc ttcggaaaaa atcatcgacc gcttggatat       840
     accaatctgg aaacgttagg ttttggctct acgatcgtga cttaccgtaa ctgtccgaac       900
     aacgcgccac ttgcactgtg ggcgggcgct ccgtggtatc cactgtttcc taggcggatt       960
     aactga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page