(data stored in ACNUC29543 zone)

EMBL: CP001044.PE256

CP001044.PE256       Location/Qualifiers
FT   CDS_pept        308936..309595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3371"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rba:RB1597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3371"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72525"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="InterPro:IPR037238"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ6"
FT                   /protein_id="ACC72525.1"
FT                   /translation="MVSSSAGVRSYTRKESVVFRKTTDEFGGLSNMAPNFPLFVVGVSV
FT                   RTSEALYQACRFPHLPDVQKLIIEQTSPMTAKMKSKPYRPESRQDWDRVRNMVMRWCLR
FT                   VKLAENWQEFGDLLLATGARPIVEDSSKDAYWGAIHVGDGIYRGENVLGRLLMELRKKL
FT                   IEDPDSLRVVKPLALSEFLLLGKHIEAVTADQAAMSEVPASVRTARLEYLRGRDGS"
     atggtttcga gttccgctgg cgttcgcagc tacacccgaa aggagtcggt ggtctttcga        60
     aagaccaccg acgagtttgg cggtctgtcc aacatggcac cgaacttccc gttatttgtg       120
     gtgggtgtat ccgttcgcac atcggaggcg ttgtaccagg cgtgtcgatt tcctcatctt       180
     cccgatgttc aaaagctcat catcgaacag acaagtccga tgacggcaaa gatgaagtca       240
     aagccctaca gaccggagtc gcgccaagat tgggatcggg tgcgcaacat ggttatgaga       300
     tggtgtctgc gtgtgaagct cgccgagaat tggcaagagt tcggagattt gttgctagcg       360
     acaggagcgc gcccaatcgt ggaggattcg tcaaaggacg cctattgggg ggctatccac       420
     gtcggcgatg gcatctatcg gggcgagaat gtactcggac ggttgctgat ggaacttagg       480
     aagaagctaa ttgaagaccc ggattcgttg cgagtagtga agccgctggc tctttctgag       540
     tttctacttc tcggtaagca tattgaagcc gtcacggcgg accaagcggc aatgtcggaa       600
     gtacctgcgt cggttcgcac tgcacgactc gaatatctgc gggggcgcga cggttcatga       660
//

If you have problems or comments...

PBIL Back to PBIL home page