(data stored in ACNUC29543 zone)

EMBL: CP001044.PE258

CP001044.PE258       Location/Qualifiers
FT   CDS_pept        310206..310604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3373"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72527"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ8"
FT                   /protein_id="ACC72527.1"
FT                   /translation="MKTQNELLDLIADESTPLADAWQAIQDLQTRFIERIARVAIEERA
FT                   DVSALVISQVMQIHKPGKAVVIDPSATLIDSAQAAHLLGVSKKSMSNYASPSTRTAYNF
FT                   PIEPIRDGRRVMWDRAAIEALAAERVIA"
     atgaaaacgc aaaacgaact tctcgacctg atcgctgatg aatcgacgcc tctcgctgac        60
     gcgtggcagg ccattcagga cctgcaaacg cgcttcatcg agcggatcgc gcgagtcgcc       120
     atcgaagaac gcgcagacgt atcggcgctg gtcatcagtc aggtgatgca gatacataaa       180
     ccgggcaagg cggtcgtgat cgatccgagc gcgacgctga tcgacagcgc gcaggcagca       240
     caccttttgg gcgtctcgaa aaagagcatg agcaattacg cgtcgccttc gacgcgtacc       300
     gcctacaact tcccaattga acccattcgc gatggccgcc gcgtgatgtg ggatcgcgcg       360
     gcgatcgaag cgctcgccgc cgaacgcgtc atcgcctga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page