(data stored in ACNUC29543 zone)

EMBL: CP001044.PE26

CP001044.PE26        Location/Qualifiers
FT   CDS_pept        complement(21259..23700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3127"
FT                   /product="glycoside hydrolase family 31"
FT                   /note="PFAM: glycoside hydrolase family 31; KEGG:
FT                   rso:RSc1081 probable glucosidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3127"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72295"
FT                   /db_xref="GOA:B2JRG8"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRG8"
FT                   /protein_id="ACC72295.1"
FT                   /translation="MATLKHPPQFSVSEAGAEPARAGQTGKPVVLCAADGARIEVFVLA
FT                   DDIIRVLVLPHGELRGPRTWSIAPGLDDVPLEGRDRHDLQGFEPVAFSAASDAERLVVE
FT                   TAKVRLTVALNGGFCSWEIARDGAWHHVMSDRKTQAYNFGWWDERVYHYVERQRGEMYV
FT                   GLGERAGTLDRANQSYEMRNIDAMGYSARSTDPLYKHIPFYVTWQPQTSLGFGLFYDTL
FT                   ADCRFDMGRELDNYHGHYRHFVAEHGDLDYYFIASADTPLHAVRRFTWLTGRPALMPKW
FT                   GLGYSGSTMSYTDAPDAQRRMGEFIERCREHDVLCDSFHLSSGYTSIGPKRYVFNWNHD
FT                   KFPDIEGFVQGYLREGVRLCPNIKPCLLQDHPAFDEAAKAGLLIQSRDGEPAWVQFWDE
FT                   VGAYLDFTNPNTIDWWKARVKDSLLRYGIASTWNDNNEFEIWTPDAIAQGFGEPFPARQ
FT                   AKVLQTQLMMRASRDAQREYAPRTRPFLVSRSGGVGMQRYVQTWSGDNYTSWETLRYNL
FT                   KMGLGLAMSGVSNSGHDIGGFSGPAPEPELLLRWVAFGIFLPRFSIHSWNDDGTVNEPW
FT                   MYPEATSTIAGLIKLRYRLIPYLYELLWQSHRSYEPVLRPMFAEFPTDPRCLVDGDDMM
FT                   LGSSLLVAPVVEKGQSERDVYLPAGVRWASYWSGEVFDGGQCITQAVPFDQPLMLLREG
FT                   SVIALNVAEQHFAQPADERAFMAVPFQGVGTAQGGCVEDDGETEAWRDGAQGRWNVAIA
FT                   SDATILRISIEREGQMPFEQTEVRLSVPASDTRAVTCTSGTVTGDSIVNGWRRLTLRLA
FT                   S"
     atggctacgt tgaagcatcc accgcagttc tccgtctccg aagcgggcgc cgagcctgcg        60
     cgcgctgggc aaaccggcaa gccggtcgtg ctctgcgctg ccgatggcgc gaggatcgaa       120
     gtgttcgtgc tcgccgacga catcatccgc gtgctcgtgc tgccgcacgg cgagttgcgc       180
     ggtccgcgta cctggtcgat cgcgcccggc ctggacgacg tgccgctcga agggcgcgac       240
     cgccacgacc tgcaaggatt cgaaccggtg gcgttcagtg cggcgagcga tgccgagcgg       300
     ctcgtcgtcg aaacggcaaa agtgcgcctg acggtcgcgc tgaatggcgg cttctgttcg       360
     tgggagatcg cgcgcgacgg cgcgtggcac cacgtgatga gcgatcgcaa gacgcaggcg       420
     tacaacttcg gctggtggga tgagcgcgtc tatcactatg tcgagcggca gcgcggcgaa       480
     atgtacgtcg gactcggcga gcgcgcgggc acgctggatc gcgcgaatca gagctacgag       540
     atgcgcaaca tcgacgcgat gggctacagc gcgcgcagca cggacccgct ctacaagcac       600
     atcccgtttt atgtgacgtg gcagccgcag acgtcgctgg gcttcggcct gttctacgac       660
     acgctggccg actgccgctt cgacatgggc cgcgagctgg acaactacca cggccactat       720
     cggcatttcg tcgccgagca tggcgatctc gactactact tcatcgcgtc ggcggatacg       780
     cccctgcacg cggtgcgccg cttcacgtgg ctcacgggac ggcccgcgct gatgccgaag       840
     tggggccttg gctattccgg ctcgacgatg agttacaccg acgcgcccga cgcgcagcgc       900
     cgcatgggtg aattcatcga gcgttgccgc gaacacgacg tgctgtgcga ttcgtttcat       960
     ctgtcgtcgg gctacacgtc gatcgggccg aagcgctacg tgttcaactg gaatcacgac      1020
     aaattccccg acatcgaagg cttcgtgcag ggctatctgc gcgaaggcgt gcggctatgt      1080
     ccgaacatca agccgtgtct gctgcaggat cacccggcct tcgacgaagc cgcaaaagcg      1140
     gggctgctga ttcaatcgcg cgacggcgag ccggcgtggg tgcagttctg ggacgaagtc      1200
     ggcgcctatc tcgacttcac gaacccgaac acgatcgact ggtggaaagc gcgcgtgaag      1260
     gacagtctgc tgcgctatgg catcgcgtcg acgtggaacg acaacaacga gttcgaaatc      1320
     tggacgcctg acgcgatcgc gcaaggcttc ggcgagccgt tcccggcgcg tcaggcgaaa      1380
     gtgctgcaaa cgcagctgat gatgcgtgcg tcacgcgatg cgcaacgcga gtacgcgccg      1440
     cgcacgcggc cgttcctggt gtcgcgctcg ggcggcgtcg gcatgcagcg ctacgtgcag      1500
     acgtggtcgg gcgacaacta tacgtcgtgg gaaacgctgc gctacaacct gaaaatgggc      1560
     ctggggctgg cgatgtcggg cgtgtcgaac agtggtcacg acatcggcgg attttcgggt      1620
     ccggcgcccg agccggaact gctgctgcgc tgggtcgcat tcggtatttt cctgccgcgt      1680
     ttcagcatcc actcgtggaa tgacgacggc actgtcaacg agccgtggat gtatcccgaa      1740
     gcgaccagca cgatcgcggg cctcatcaag ctgcggtatc ggctgattcc gtatctgtat      1800
     gaactgctgt ggcagtcgca tcgctcgtat gagccggtgc tgcgcccgat gttcgcggag      1860
     tttccgaccg atccgcgctg ccttgtggat ggcgacgaca tgatgctcgg ttcatcgctg      1920
     ctggtggcgc ccgtcgtcga gaaagggcag agcgagcgcg acgtgtatct gccggcgggc      1980
     gtgcgctggg cgtcgtactg gagcggcgag gtgttcgacg gcgggcaatg catcacgcaa      2040
     gccgtgccgt tcgatcaacc gctgatgctg ctgcgggaag gcagcgtgat tgcgttgaac      2100
     gtcgccgagc agcacttcgc gcagcccgcc gacgagcgcg cgttcatggc ggtgccgttc      2160
     cagggcgtcg gcacggcgca gggcggatgc gtcgaagacg acggcgaaac ggaagcatgg      2220
     cgcgatggcg cacagggccg ctggaacgtc gcgattgcca gcgatgcgac catcttgcgc      2280
     atttcgatcg aacgcgaggg gcagatgccg ttcgagcaga cggaagtgcg gctcagtgtg      2340
     cctgcatccg acacgcgcgc tgtgacgtgc acgagcggca ccgtgacagg cgattccatc      2400
     gtcaacggct ggcgccgcct gacgctgcgt ctcgcgagct ga                         2442
//

If you have problems or comments...

PBIL Back to PBIL home page