(data stored in ACNUC29543 zone)

EMBL: CP001044.PE260

CP001044.PE260       Location/Qualifiers
FT   CDS_pept        311041..311256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3375"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72529"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL00"
FT                   /protein_id="ACC72529.1"
FT                   /translation="MPKAPDYLIALTAETDKGEAHTALTGQELNAVLKLLTRVAFANEE
FT                   APADPFERACMITAVRKLQRMIIDVL"
     atgccaaaag cgccggatta tctgatcgcg ctaacagcag aaacggacaa gggcgaagcg        60
     cacaccgccc tgacagggca ggaactgaac gcggtgctca aactgttgac gcgggtcgcg       120
     ttcgcgaacg aggaagcgcc cgctgacccg tttgagcgtg cctgcatgat tactgccgtc       180
     cgcaaactgc aacgaatgat tatcgacgta ctctga                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page