(data stored in ACNUC29543 zone)

EMBL: CP001044.PE263

CP001044.PE263       Location/Qualifiers
FT   CDS_pept        complement(313855..314034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3378"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72532"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL03"
FT                   /protein_id="ACC72532.1"
FT                   /translation="MKINLYNEGDNPIRVIIDGDTVNDSTLEPGEERFIESRDAGVIEL
FT                   RELDGPQAATDPSD"
     atgaagatca acttgtacaa cgaaggcgat aacccgatcc gcgtcatcat cgacggcgac        60
     acggtgaacg attcgacgct tgaaccgggc gaagaacggt tcatcgagag ccgcgatgcg       120
     ggcgtgatcg aactgcgcga actggacgga ccccaggcgg cgacggaccc ctccgactag       180
//

If you have problems or comments...

PBIL Back to PBIL home page