(data stored in ACNUC29543 zone)

EMBL: CP001044.PE266

CP001044.PE266       Location/Qualifiers
FT   CDS_pept        complement(314761..315546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3381"
FT                   /product="Tail Collar domain protein"
FT                   /note="PFAM: Tail Collar domain protein; KEGG:
FT                   hau:Haur_1973 tail collar domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3381"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72535"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL06"
FT                   /protein_id="ACC72535.1"
FT                   /translation="MTQVPNYQVPAHPSGLDMRTQLNNIVLALIGDNSGPVAPTQTYPG
FT                   MWWGDTTAKRWKHRTNADDGWIDVGPLDDILGDFRSASPKGTIIMWWGDGTKIPTGWAK
FT                   CDGTQGTPNLTDKVPVCAGGTYASGATGGANTVTLSASQMPVHAHGISDPGHGHGVADG
FT                   GHNHSVWDNGHQHTLPNLGSVQAGSDNGGASSPVSTGYGSSRYQNPTDAGGGNHGNNAS
FT                   GAGIGIYGNGTGIGIQNAGGGAAVDIRQPYYALWFLMKL"
     atgacacagg tccccaacta ccaggttccc gcgcatccgt ccggtctcga catgcgcacg        60
     cagctgaaca acatcgtgct tgcgctgatc ggcgacaaca gcgggcccgt agcacccacg       120
     cagacctatc cgggcatgtg gtggggagat acgaccgcga agcgctggaa gcaccgcacg       180
     aacgcggacg acgggtggat cgatgtcggt ccgctcgatg acattctcgg cgacttccgc       240
     agcgcgtccc ccaaggggac gatcatcatg tggtggggcg atggcacgaa gatccccacg       300
     ggctgggcga agtgcgacgg cacacagggg acgcccaacc tgacagacaa ggtacccgtc       360
     tgtgccggtg gcacgtatgc atcgggcgcg acgggtggcg cgaacacggt cacgctctcg       420
     gcgagccaga tgcccgtgca tgctcacggc atcagcgatc cggggcacgg gcacggcgta       480
     gcggacggcg gccacaatca cagcgtatgg gacaacggcc accagcacac gcttcctaac       540
     ctcggttcgg tgcaagcggg ttcggacaac ggcggtgcga gcagcccggt atcgacgggc       600
     tacggatcga gccgctacca gaacccgacc gacgcgggcg ggggcaatca cggcaacaac       660
     gcgagcggcg cgggtatcgg catctatggg aacggaaccg gcatcggcat ccagaacgcg       720
     ggcggcggcg ctgccgtcga tatccggcag ccgtattacg cgctgtggtt cctgatgaag       780
     ctctag                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page