(data stored in ACNUC29543 zone)

EMBL: CP001044.PE267

CP001044.PE267       Location/Qualifiers
FT   CDS_pept        complement(315543..318854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3382"
FT                   /product="Phage-related protein tail component-like
FT                   protein"
FT                   /note="KEGG: rso:RSc1698 probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3382"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72536"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="InterPro:IPR037221"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL07"
FT                   /protein_id="ACC72536.1"
FT                   /translation="MNSRDLVPVAGAGGGGGKGGGGGSRSPVEAPDSLRSVQYARVINL
FT                   LCEGEIEGIVGNAAGIYVDDTPLANADGSWNFNGAAIEWRTGTAQQAPISGFSATESES
FT                   TVGVTVTAAAPVTRSITNPNVTAIRVTLGFPQMTSLDTTTGDLSGTSVQLAIDVQRNGA
FT                   GFQTFYTDTVTGKTTSRYQRSYRLGLSRFGVLGGTYDIRVRRITPDSTTSNLQNAFQWE
FT                   TMTEIVDSQLMYPYCALVGVQIDASTFKSIPKLSFDTQLRRVQIPSNYDPPTRTYTGVW
FT                   DGTFKVAWSDNPAWIVYDLSVTQRFGLGAYLSPALIDKWTLYSIGQYCDGMVNNGFGQL
FT                   EPRYTCNCYIQERADAITLLQHFASIFNGLIFWSGGALTFSADMPADAVDEFSPSKIID
FT                   GAFNYVGSPLNQRHTIALVTWNDPAQKYAQAIEYVEDAEAIAQWGIRELQIQAFGCTSR
FT                   GQAHRVGRWALLTERYLSESVTFKTGVNAAFVRPGDVFLTTDPTRAGARMGGRVLDGGT
FT                   DWLTLDASVNLTTDTSWSISVMLPDGTFATRALLVTQDGPQATVHLAQALPIAATRMCA
FT                   WAISGGTLQMEQWRCTSASEDEDGNIEIAGIAYRPDKFAAIEADLKLEPLPTSIIDPFN
FT                   VGPCTELDVTESKYLISPMVVGSRATFSWLAPVGAVRFAVSYQHEQDSPVYADCFMNSI
FT                   DIQPTEEGTWYFTVWAINSIGIRSAPASITVQLRALNQPPEDVKGFQLTVINDSANLGW
FT                   IASTDLDVTVGGQVAIRFSTRLTTAVMWEEASDIARFSGSQSSGYTLLMKGTYLAKFIN
FT                   SSGAYSENPAYVISTTGPLRDYNLVANLQQDPTFTGVKQNMIVRNGILFLDQNPDTGLV
FT                   VSTQGGYYFDRVVDMGKVYTVRCSTYNEGAVYDVTDDVDTWPDFDARSDVDGTKINEGG
FT                   SLVLASITNVDPNVAQAADWSPWTRLVVADLTFRAVRFSLAVKVPDTTHGIGITSLGAI
FT                   VDVPDRIESRNNVPVAATGSSITFSVPFKAAPAISIIAQGLASGDKWSITNQSATGFTI
FT                   QFQNSGGTGIAKTCDWIARGYGYEHVDLDGLGWSALMKGDIERLLADRQRMGVTP"
     atgaactccc gcgatctggt tcccgttgct ggcgcaggtg gtggcggcgg caagggaggc        60
     ggcggcggat cgcgctcgcc cgtcgaggca cccgacagtc tccggtccgt ccagtacgcc       120
     cgcgtgatca acctgctatg cgagggcgag atcgagggca tcgtcggcaa cgcggcgggg       180
     atctacgtcg atgacacgcc gcttgcgaac gcggatggct cgtggaattt caacggcgcg       240
     gccatcgagt ggcgcacggg taccgcgcaa caggctccga tctcgggctt ttccgcgacc       300
     gagtccgaat cgacggtcgg tgtcacggtc acggcggccg cgcccgtcac gcgctcgatc       360
     accaatccga acgtcaccgc gatccgcgta acgctcggct ttccgcagat gacctcactc       420
     gacacgacca cgggtgatct gagcgggaca tcggtgcagc ttgcgatcga cgtgcagcgc       480
     aacggcgcgg ggttccagac gttctacacg gacacggtga cgggcaagac cacgagccgc       540
     tatcagcgct cgtatcgcct cggcctctcg cgcttcggcg tgctcggcgg cacctacgat       600
     atccgcgtgc ggcgcatcac gcccgactcg acgacctcga atctccagaa cgcgttccag       660
     tgggagacga tgaccgagat cgtcgactcg caactgatgt atccgtactg cgcgctcgta       720
     ggcgtacaga tcgacgcctc gacgttcaag agcatcccga agctgtcctt cgatacgcag       780
     cttcggcgcg tccagattcc ctcgaactac gacccgccga cgcgcaccta tacgggcgtg       840
     tgggacggaa cattcaaggt cgcatggtcc gacaacccgg cgtggatcgt gtacgacctt       900
     tccgtcacgc agcgcttcgg gctcggcgcg tacctgtcgc ccgcgctgat cgacaagtgg       960
     acgctgtaca gcatcggcca gtactgcgac ggcatggtca ataacggctt cggccagctt      1020
     gagccgcgct atacgtgcaa ctgctacata caggagcggg ccgacgcgat cacgctgctt      1080
     cagcatttcg cgagcatctt caacggcctg atcttctgga gcggcggcgc actgacgttc      1140
     agcgctgaca tgcccgccga tgccgtcgat gaattcagcc cgtcgaagat catcgacggc      1200
     gcgtttaact acgtgggctc gcctctgaac cagcggcata cgatcgcgct cgtcacgtgg      1260
     aacgatcccg cgcagaagta cgcgcaggcg atcgagtatg tagaggacgc ggaagccatc      1320
     gcgcagtggg gaatccgtga actccagata caggctttcg gctgcacgtc gcgcggtcag      1380
     gcgcacaggg tcggacgctg ggcgctgctg accgagcgct acctgtcgga gtcggtgacg      1440
     ttcaagacgg gcgtcaatgc cgcgttcgtg cgtcccggcg atgtgttcct cacgaccgat      1500
     ccgacgcgtg cgggcgcgcg catgggtggc cgcgtgctcg atggcgggac cgactggctc      1560
     acgctcgacg cgtccgtcaa tctgacgacc gacacatcat ggtcgatctc agtgatgctg      1620
     cccgatggca cgttcgccac ccgtgcgctg ctcgtcacgc aggacggtcc gcaggcaacc      1680
     gtccaccttg cgcaggcgct acccatcgcg gccacgcgca tgtgcgcctg ggcgatctcg      1740
     ggcggcacgc tccagatgga acagtggcga tgcacgtcag cgagcgagga cgaggacggc      1800
     aatatcgaga tcgcgggcat cgcctaccgg ccggacaagt tcgcggcgat cgaggcggat      1860
     ctgaagctcg aaccgctgcc gacctcgatc atcgatccgt tcaatgtcgg gccgtgtact      1920
     gaactggacg tgaccgagtc gaagtacctg atcagtccga tggtggtcgg ctcgcgcgcg      1980
     acgttctcat ggctcgcgcc cgtgggcgcg gtacgcttcg cggtgtcgta ccagcatgaa      2040
     caggactcgc ccgtgtacgc ggactgtttc atgaacagca tcgatatcca gccgaccgag      2100
     gaaggcacgt ggtacttcac ggtgtgggcg atcaactcga taggcatccg cagcgcgccc      2160
     gcgtcgatta cggtgcagct gcgcgcgctt aaccagccgc ccgaagatgt gaagggcttc      2220
     cagcttaccg tcatcaacga cagcgcaaat ctcggctgga ttgcctcgac cgatctcgat      2280
     gtcacggtgg gcggtcaggt ggcgatccgc ttctcgaccc gcctcacgac cgccgtgatg      2340
     tgggaggaag ccagcgacat cgcgcgcttc tcgggctcgc agtcgagcgg ctacacgctg      2400
     ctgatgaaag gcacgtatct ggcgaagttc atcaactcaa gcggcgcgta ttccgagaac      2460
     ccggcctacg tcatcagcac gaccggaccg ctgcgtgatt acaacctcgt ggcgaatctc      2520
     cagcaggacc cgacctttac gggcgtcaag cagaacatga tcgtgcgcaa cggcatcctg      2580
     ttcctcgatc agaacccgga cacgggactc gttgtgtcga cacagggcgg ctactacttc      2640
     gaccgcgtgg tcgatatggg caaggtctac acggtccgat gctcaacgta caacgagggg      2700
     gccgtctatg acgtgaccga tgacgtggac acgtggcccg acttcgatgc gcgttccgat      2760
     gtcgatggca cgaagatcaa cgaaggcggc tcgctcgtgc tcgcgtcgat caccaacgtc      2820
     gatccgaatg tggcgcaggc ggccgactgg tctccgtgga cccggcttgt cgttgccgat      2880
     ctgacgttcc gtgcggtgcg cttctcgctc gcggtcaagg tacccgatac cacgcacggc      2940
     attggcatta ccagcctcgg ggccatcgtc gatgtgcctg accggatcga gagccgcaat      3000
     aacgttcccg tcgcggcgac cggttcgtcg atcacgttca gcgtgccgtt caaggccgcg      3060
     cccgcgatca gcatcatcgc ccaggggctc gcgagcggcg acaaatggtc gattacgaac      3120
     cagagcgcaa ccggcttcac catccagttt cagaactccg gcggcacggg catcgcgaag      3180
     acctgcgact ggatcgcgcg cggctacgga tacgagcacg tggaccttga cgggctcgga      3240
     tggtcggcgc tcatgaaggg cgatatcgaa cgactgctgg ctgaccgtca gcgtatggga      3300
     gtcacgccat ga                                                          3312
//

If you have problems or comments...

PBIL Back to PBIL home page