(data stored in ACNUC29543 zone)

EMBL: CP001044.PE268

CP001044.PE268       Location/Qualifiers
FT   CDS_pept        complement(318854..319423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3383"
FT                   /product="lambda tail assembly I"
FT                   /note="PFAM: lambda tail assembly I; KEGG: rso:RSc1696
FT                   probable phage HK022 GP20-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3383"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72537"
FT                   /db_xref="GOA:B2JL08"
FT                   /db_xref="InterPro:IPR010654"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL08"
FT                   /protein_id="ACC72537.1"
FT                   /translation="MLTVLFYGDLRRRFGRRYVLDVHSPREAILALCLQLDGLRRYFRD
FT                   HATQNFLVRGYQDYDESDLDYPQSTGTLKVVPLVAGAGAWGKIIGGAALAVVGFVISPY
FT                   SGGLGMALVSMGLSMALGGVAQMLAPRASGSATPEKADNQPSLAFDGAVNTTGQGGPVP
FT                   LGYGRMIVGSQVISVGFSTNNEIVVN"
     atgctcaccg tgcttttcta tggcgacctt cgccggcgct tcggccgtcg ctatgtgctc        60
     gacgtgcatt cgccgcgcga agcgatcctc gcgctttgct tgcagcttga cgggctgcgc       120
     cgctacttcc gcgatcacgc gacccagaat tttctcgtgc gcggatacca ggactatgac       180
     gaatccgatc tcgactatcc gcagtccacg ggcacactca aggtcgtccc gctggtcgcg       240
     ggcgcgggcg cgtggggaaa gatcatcggc ggcgcagcgc ttgcagtggt gggcttcgtg       300
     atcagcccat actcgggcgg gctcgggatg gcgctcgtca gcatggggct gtcaatggcg       360
     ctgggcggtg tcgcgcagat gcttgcgccg cgcgcatccg gcagcgcgac gccagagaaa       420
     gccgacaacc agccttcgct cgcgttcgat ggcgcggtca acacgaccgg ccagggcggt       480
     cccgtgccgc tcggctatgg gcgcatgatc gtcggctctc aggtgatcag cgtgggcttc       540
     tcgaccaata acgagatcgt ggtgaactga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page