(data stored in ACNUC29543 zone)

EMBL: CP001044.PE27

CP001044.PE27        Location/Qualifiers
FT   CDS_pept        complement(23724..25031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3128"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RSc1080 putative hexuronate transporter transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3128"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72296"
FT                   /db_xref="GOA:B2JRG9"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRG9"
FT                   /protein_id="ACC72296.1"
FT                   /translation="METQLKTIIGLRWWIIALVCLGTIVNYLSRNALGVMAPELKTLLH
FT                   MNTQQYSYVVGAFQIGYTIMQPVCGLVIDLIGLRLGFALFACLWSATGMLHGLASGWLS
FT                   LAALRGLMGLSEAVAIPAGMKVVAEWFPNREKSVAVGYFNAGTSLGSLFAPPLVVFLSL
FT                   RYGWQSAFAVTGAMGFVWAALWYVFYRAPADHKRISDKERATITEGQTPPAAYAQDKRR
FT                   IREVLGTRRFWAIAQARFFAEPAWQTFSFWIPLYLATERHMDLKQIALFAWLPFLAADL
FT                   GGLFGGYLSPFLMKRLRVPLIWSRIAGVVLGAFMMIGPACIGLVASPYEAIALFCVGGF
FT                   AHQMISALVNTLAADVFEPGEVGTAAGFAGMAAWIGGLGFSLMVGALADKIGYTPLFGA
FT                   LGAFDLIGAALLVILMRGVTRDARLQRVGNGAGSAA"
     atggagacac agttgaagac aatcattggc ctgcgctggt ggatcatcgc gctcgtgtgc        60
     ctcgggacga tcgtgaacta cctgtcgcgc aacgcgctcg gcgtcatggc gccggagctg       120
     aaaacgctgt tgcacatgaa cacgcagcag tactcctatg tcgtcggcgc gtttcagatc       180
     ggctacacga tcatgcagcc tgtatgcggg ctggtcatcg acctcatcgg cctgcgcctg       240
     ggtttcgcgc tgttcgcgtg cctgtggtcg gcgacgggta tgctgcacgg tctcgcgagc       300
     ggctggctgt cgcttgctgc gttgcgcggg ttgatgggac tgtcggaggc cgtggccatt       360
     ccggcgggca tgaaagtggt cgccgaatgg tttccgaacc gcgagaagtc ggttgccgtc       420
     ggctatttca atgcgggcac gtcgctcggt tcgctgttcg cgccgcctct ggtggtgttc       480
     ctgtcgctgc gctacggctg gcagagcgcg tttgccgtga cgggcgcgat gggtttcgtg       540
     tgggcggcgc tgtggtacgt gttctatcgc gcgcccgccg accacaaacg catcagcgac       600
     aaagaacgcg cgaccatcac ggaagggcag acgccgcctg ctgcttatgc gcaggacaag       660
     cggcgcatcc gtgaagtgct cggcacgcgc cgcttctggg cgatcgcaca agcgcgcttt       720
     ttcgcggagc cggcctggca gaccttcagc ttctggattc ctctctatct cgccaccgaa       780
     cggcacatgg acctgaagca gatcgcgctg tttgcgtggc tgccgttcct tgccgcggac       840
     ctaggcggtc tgttcggcgg ctatctgtcg ccgttcctga tgaagcggct gcgcgtgccg       900
     cttatctggt cgcgtatcgc gggcgtcgta ctgggcgcgt tcatgatgat cgggccggcg       960
     tgcatcgggt tggtcgcttc gccatacgaa gcgatcgcgc tgttctgcgt cggcggcttc      1020
     gcgcaccaga tgatctcggc gctcgtcaac acgctcgccg ccgacgtctt cgaacccggc      1080
     gaggtcggca cggcggctgg ttttgcgggc atggcggcgt ggatcggcgg actcggcttc      1140
     tcgctgatgg tgggcgcgct cgccgacaag atcggctaca cgccgctgtt cggcgcactc      1200
     ggcgctttcg acctgatcgg cgcggcactg ctcgtgatcc tcatgcgcgg cgtgacgcgc      1260
     gacgcccgtc tgcaacgtgt cggaaacggc gcgggcagcg cggcctga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page