(data stored in ACNUC29543 zone)

EMBL: CP001044.PE270

CP001044.PE270       Location/Qualifiers
FT   CDS_pept        complement(320152..320850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3385"
FT                   /product="phage minor tail protein L"
FT                   /note="TIGRFAM: phage minor tail protein L; PFAM: minor
FT                   tail protein L; KEGG: ypp:YPDSF_4037 phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3385"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72539"
FT                   /db_xref="InterPro:IPR006487"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL10"
FT                   /protein_id="ACC72539.1"
FT                   /translation="MKLNGAIQELAPGAVIQLFVLDLSAYHVPSGNEITRFHAGTNEIG
FT                   GDVVWQGNTYQRFPVQATGFEFKGQGTLPRPHFAVSNVGGIISALCREYSDMVGAPVTR
FT                   KRTLARYLDAVNFADGNPLADPTEGFPDDVFYVNQKLRESVDVCEFELAVAFDVQGVQL
FT                   PRRQVICNSCPWEYRGDGCGYAGGPVADINDNPTSDPNRDACGKRLASCRLRFAGWVPF
FT                   GGFPGAGQYR"
     atgaagctca acggcgcaat acaggaactg gcccccggcg cggtgatcca gttgtttgtg        60
     ctcgatctgt ccgcctatca cgtcccgtca ggcaacgaga tcacgcgctt tcacgccggc       120
     acgaacgaga tcggcggcga tgtcgtatgg cagggaaaca cctatcagcg ctttcccgtt       180
     caggcgacgg gcttcgaatt caaggggcaa ggtacgctgc cgcgcccgca cttcgcggtg       240
     tcgaacgtgg gcgggattat cagcgcgcta tgccgcgaat acagcgacat ggtcggcgcg       300
     cccgtcacgc gcaagcgcac gctcgcgcgc tacctcgacg cggtgaactt cgcggacggc       360
     aatccgctcg cggaccccac cgaaggcttt cccgacgatg tcttctatgt gaaccagaag       420
     ctgcgcgagt cggtggacgt atgcgagttc gagcttgccg tcgcgttcga tgttcagggc       480
     gtgcagctac ctcgccggca ggtcatctgc aatagctgtc cgtgggagta ccggggcgac       540
     ggctgcggct atgcgggcgg acccgtggcc gacatcaacg acaaccccac cagcgacccg       600
     aacagggacg cgtgcggcaa gcggctcgca agctgccgcc tgcgcttcgc gggctgggtt       660
     ccgttcggcg gttttcccgg tgcaggacag taccgatga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page