(data stored in ACNUC29543 zone)

EMBL: CP001044.PE273

CP001044.PE273       Location/Qualifiers
FT   CDS_pept        complement(323584..323916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3388"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72542"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL13"
FT                   /protein_id="ACC72542.1"
FT                   /translation="MTDLSQPVRAFDLTLASETVETECFGAVTISDIGADGIERIASHM
FT                   REAGLSDDREMARQLLCESASGPNGERFTAEGLAHMPARAFRDRIKLLTAAMRVNGLSQ
FT                   VDVEKA"
     atgaccgacc tttcccagcc cgtgcgcgcg ttcgatctca cgctggcgag cgagaccgtc        60
     gagaccgaat gctttggcgc agtcacgatc agcgatatcg gtgcggacgg tatcgagcgc       120
     atcgcgtcgc acatgcgcga agcgggcctg tctgacgatc gtgagatggc gcgccagctg       180
     ctgtgcgaat ccgcaagcgg tcccaatggc gagcgcttca ctgccgaggg actggcgcac       240
     atgcccgccc gtgcgttccg cgaccgtatc aagctgctca ccgcggcgat gcgcgtcaat       300
     ggcctgtctc aggtggacgt ggaaaaagca tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page