(data stored in ACNUC29543 zone)

EMBL: CP001044.PE274

CP001044.PE274       Location/Qualifiers
FT   CDS_pept        complement(323924..324856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3389"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72543"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL14"
FT                   /protein_id="ACC72543.1"
FT                   /translation="MKKAISAQGTKMFLENPDAAPIATGLLMAGSVSTPCVVTFDNVTK
FT                   MANGEPLYITGSGWPSIDDQEWVIQNLDKTAKTASLANSDTSKETATWNAAASYTLNAF
FT                   ADVCAQSYQINQNPATTIDTTTLCDSEKTSLVGFRDPGTLTFDFFIDPTDPDYLALHDA
FT                   YDDGEERMFELIYKNGAVRTLPVIVQSINETGGVDQAVHGSATLKITGSPILTQPGSTT
FT                   PPVYALTVDVAPASGVAPLSVTATMAETNGTASQFQIDWGDTTAIDTVTGSLTKTHDYA
FT                   AAGSYTAHVTPTVNSSVLAPVAANAVTVS"
     atgaaaaagg caatcagcgc acaaggcacg aagatgtttc ttgagaaccc ggacgccgcg        60
     ccgattgcga cgggtctgct catggcgggc agcgtatcga cgccatgcgt ggtgacgttc       120
     gataacgtca cgaagatggc gaacggtgaa ccactctaca tcacgggctc agggtggccg       180
     agcatcgacg atcaggagtg ggtgatccag aaccttgaca agactgccaa gaccgcgtcg       240
     ctcgcgaaca gcgacacgtc caaggagacg gccacgtgga acgccgccgc gagctatacg       300
     ctcaacgcct tcgcggacgt gtgcgcgcag tcctaccaga tcaaccagaa ccccgcgacc       360
     acgatcgaca cgaccacgct ctgcgacagc gaaaagactt cgcttgtcgg ctttcgagac       420
     cccggcacgc tcacgttcga cttcttcatc gatcccaccg atcccgacta tctcgcgctg       480
     catgacgcgt acgacgatgg cgaggaacgc atgttcgaac tgatctacaa gaacggcgcg       540
     gtgcgcacgc tgcccgtgat cgtgcagtcg atcaacgaga caggcggtgt cgatcaggct       600
     gtccacggtt cggccacgct caagatcacg ggctccccga tcctcacgca gcccggcagc       660
     acgacgcccc ctgtctatgc gctgacagtc gatgtcgcgc cagcatcggg tgtcgcgccg       720
     ctcagcgtga cggcgacgat ggctgagacg aacggcacgg cgagccagtt ccagatcgac       780
     tggggcgaca cgacggcaat cgacacggtg acgggcagcc tgacgaagac ccacgactat       840
     gcagcggccg gaagctacac ggcgcacgtt acgccgaccg tcaacagcag cgtgctcgcg       900
     cccgtcgcgg ccaatgccgt gaccgtctcg tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page