(data stored in ACNUC29543 zone)

EMBL: CP001044.PE276

CP001044.PE276       Location/Qualifiers
FT   CDS_pept        complement(325205..325714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3391"
FT                   /product="phage protein, HK97 gp10 family"
FT                   /note="TIGRFAM: phage protein, HK97 gp10 family; PFAM:
FT                   TP901-1 ORF40 family protein; KEGG: asu:Asuc_1243 phage
FT                   protein, HK97 GP10 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3391"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72545"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL16"
FT                   /protein_id="ACC72545.1"
FT                   /translation="MRVYVEQHVEGLAELDRFLSTLPENIQRKMLNSALRAAGKPVLDQ
FT                   AKQNIRSLFGSSPRYTGTLEAGVVIAKQRNTGLAARVNVKTKKPRGNKTNDVIHGVKKP
FT                   YGRDPFYGRFLEKGTSKMPARPFLGPAGYARQSDAGRALNASLQQQIARWCKANGVKFV
FT                   PGGAYD"
     atgagggtct atgtcgaaca gcacgtcgag gggctggcag agcttgaccg tttcctctcg        60
     acgctgcctg agaacatcca gcgcaagatg ctcaactcgg cgctgcgcgc ggcgggcaag       120
     ccagtactcg atcaggcgaa gcagaacata cgctcgctgt tcggatcgag tccgcgctat       180
     acgggcacgc tcgaagcggg cgtggtcatc gcgaaacagc gcaatacggg actggccgca       240
     cgcgttaatg tgaagacgaa gaagccacgc ggcaacaaga ccaacgacgt gatccacggg       300
     gtgaagaagc cgtacggccg cgatccgttc tatggacgct tccttgagaa aggcacatcg       360
     aagatgcccg cgcgtccgtt ccttggcccc gccggttatg cccgccagag cgatgcgggc       420
     cgtgcgctca atgcctcgct ccagcagcag atcgcgcgat ggtgcaaggc caacggcgtg       480
     aagttcgttc cggggggggc gtatgactga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page