(data stored in ACNUC29543 zone)

EMBL: CP001044.PE278

CP001044.PE278       Location/Qualifiers
FT   CDS_pept        complement(326055..326630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3393"
FT                   /product="phage conserved hypothetical protein, phiE125
FT                   gp8"
FT                   /note="KEGG: pla:Plav_0908 phage conserved hypothetical
FT                   protein, phiE125 gp8"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3393"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72547"
FT                   /db_xref="InterPro:IPR011738"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL18"
FT                   /protein_id="ACC72547.1"
FT                   /translation="MDSIVIAATGDSEEPVTVDMAKAHCRVDVDDDDALFESIYIPAAR
FT                   QTVEQYTGLTLLSCDVDVLVCQCDVTQNVIAVPVQPVASVTALATVDANGVQTPLDLDE
FT                   YGIAVAKVGMRSVIVARNGPLPSAPYYRVQYVAGYAENATPPNLLLAILEYVGDAYENR
FT                   EAQQTSQAINDNPRAVRLMDPFRITFGL"
     atggacagca tcgtcatcgc cgcgaccggc gacagtgaag aacccgtcac ggtggatatg        60
     gccaaggcgc attgtcgtgt ggacgtggat gatgacgatg cactgttcga gtcgatctac       120
     attccagccg cgcgtcagac cgtcgagcag tacacggggc tgacgctgct ctcgtgcgat       180
     gtcgatgtgc tggtctgcca gtgcgatgtc acgcagaacg tgatcgcggt tcccgtgcag       240
     cccgttgcga gcgtgaccgc gctcgcgacc gtggatgcca acggcgtaca gacgccactc       300
     gatctcgacg agtacgggat cgcggtcgca aaggtcggga tgcgctcggt catcgtcgcg       360
     cgcaacggcc cgctaccgtc agcaccgtac taccgcgtgc agtacgtcgc gggctacgcg       420
     gaaaacgcga cgccgcccaa tctgctgctg gcgatcctcg aatacgtggg cgacgcgtac       480
     gagaaccgcg aggcgcagca gaccagtcag gcgatcaacg acaacccgcg cgcggtccgg       540
     ttgatggacc cgttccgcat caccttcgga ctctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page