(data stored in ACNUC29543 zone)

EMBL: CP001044.PE286

CP001044.PE286       Location/Qualifiers
FT   CDS_pept        complement(334208..334924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3401"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72555"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL26"
FT                   /protein_id="ACC72555.1"
FT                   /translation="MIPSIWRRRAAAAGFAIVSTSSAYGTAPVVNQGNAYANVPAPTNI
FT                   SAGNFLYAFYVADELTITPTLACSGWTTHRTYQYSGNNNYGFIGALYKVATASEPASYS
FT                   FGGTGVNTFSLCILNMTGVVTSDPFSGVTPTNAKANSATTTFATVTRPRAGAQLLVAVT
FT                   GSSYSPNVANAWTPPASYTLAGQITDLYNQPGKGEAQAAFSAVRTNAPAGATGSMTGTL
FT                   GKSYYNGTMNVVLNTG"
     gtgatcccgt caatctggcg acggcgtgcg gcggccgccg ggttcgccat cgtctcgaca        60
     tcgagcgctt acgggaccgc tcctgtcgtg aatcagggca acgcatacgc gaacgtgcca       120
     gcgcccacga atatcagcgc gggcaacttc ctgtatgcgt tctacgtcgc ggatgaactg       180
     acgatcacgc cgacgcttgc gtgcagcggc tggaccacgc atcgcacgta ccagtattcg       240
     gggaacaaca attacggatt catcggtgcg ctgtacaagg tcgcaacagc atcggagccc       300
     gcgtcctatt cgttcggtgg aacaggcgtc aatacgttca gcctgtgcat cctgaacatg       360
     acaggcgtgg tcacgtccga tccgttcagt ggtgtcacgc cgaccaacgc gaaagcgaac       420
     agcgccacga ccacgttcgc cactgtcacg cgcccgcgcg cgggtgcgca gctgctggtc       480
     gcggtgacgg gttcgagcta ttcgcccaac gtcgcgaacg cctggacccc gcccgccagc       540
     tacacgctcg caggccagat cacggatctg tacaaccagc ccggcaaggg ggaggcacag       600
     gccgcgttct ctgctgtgcg tacgaacgca ccggcgggtg cgacgggcag catgacaggc       660
     acgcttggca agagctacta caacggcacg atgaacgtcg tgctgaacac gggatga          717
//

If you have problems or comments...

PBIL Back to PBIL home page