(data stored in ACNUC29543 zone)

EMBL: CP001044.PE289

CP001044.PE289       Location/Qualifiers
FT   CDS_pept        complement(337424..337795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3404"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72558"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL29"
FT                   /protein_id="ACC72558.1"
FT                   /translation="MKPGNYPLDIYRGDTYRWQFTLWSDTDKTQPVDLTDVIARSQIRD
FT                   KPAGKLLATIDCAITLPNVILGTLSADECAKLTATKCAWDLQLEWPNTDITTLLAGDVT
FT                   VTIDVTDSAPTLVSVKASA"
     atgaaacccg gtaactatcc gctcgacatc tatcggggcg acacgtaccg ctggcagttc        60
     acgctgtggt ccgacacgga caaaacgcag cccgtggacc tgacggacgt aatcgcgcgc       120
     tcgcagatcc gcgacaagcc ggcgggcaag ctgctcgcga cgatcgactg tgcgatcacg       180
     ctgccgaacg tgatcctcgg cacgctgagc gccgacgagt gcgcgaagct aaccgcgaca       240
     aaatgtgcgt gggatctgca actggaatgg ccgaacacgg atatcacgac actgctcgcg       300
     ggtgatgtca cggtcacgat cgacgtgacc gactccgcgc ccactctcgt cagcgtgaag       360
     gcgtcagcat ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page