(data stored in ACNUC29543 zone)

EMBL: CP001044.PE293

CP001044.PE293       Location/Qualifiers
FT   CDS_pept        complement(339046..339300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3408"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72562"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL33"
FT                   /protein_id="ACC72562.1"
FT                   /translation="MNRKTTESLAMRQHLAHDNDRMREALRTIVAMAETSPSALTMNDI
FT                   ARIARAALIAIPRENPALRHPETKEASCSTNACGPAAAG"
     atgaaccgga aaacaaccga atcgctcgcg atgcgccagc atctggcgca tgacaacgac        60
     cgcatgcgcg aagcgctgcg caccatcgtc gcgatggccg agaccagtcc gagcgcgctg       120
     acgatgaacg acatcgcgcg tatcgcgcgt gccgcgctga tcgcgatccc gcgcgagaac       180
     ccggcattgc gccaccccga aaccaaggag gcatcgtgca gcacgaatgc ctgtggcccg       240
     gctgcggccg gctga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page