(data stored in ACNUC29543 zone)

EMBL: CP001044.PE296

CP001044.PE296       Location/Qualifiers
FT   CDS_pept        complement(340272..340820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_A2361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3411"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72565"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL36"
FT                   /protein_id="ACC72565.1"
FT                   /translation="MTRAIPEHWLERLFARMESIYGSRFHDMWRDCEIAEVKATWREGL
FT                   AGITDEGLKRGVAALFHEKSPPTLPRFLELCQPQPAMHMPNRLLTDEVGCTPSHEARAQ
FT                   LAEIAKRIGMREPGIAWARRIFDEAARGHVLPGSRLQVALDAIKSWDATHGAIHREREP
FT                   GCDDEESLVADATTSPEQE"
     atgacccgcg ccattcctga gcattggctt gaacgtctgt tcgcgcgcat ggagtcgatc        60
     tacggttcgc gcttccacga catgtggcgc gattgcgaaa tcgccgaggt caaggcgacg       120
     tggcgagaag gtctcgcggg catcaccgac gaagggctga aacggggcgt agccgcgctg       180
     ttccacgaaa aaagcccgcc gacgctgccg cgtttccttg agctttgcca gccgcagcct       240
     gcgatgcaca tgccgaaccg tctgctgacc gacgaggtcg gctgcacgcc atcgcatgaa       300
     gcgcgcgcgc agttggccga gatcgcgaag cgcatcggca tgcgcgagcc gggtatcgca       360
     tgggcgcgcc gcattttcga cgaagcggcc cgcggtcacg tgctaccggg aagccggcta       420
     caggtcgcgc tcgacgcgat caaaagctgg gatgccaccc acggcgcgat tcaccgcgag       480
     cgcgaacccg gatgcgatga cgaagaaagc ttggttgcag atgcaacgac atcacccgaa       540
     caggagtaa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page