(data stored in ACNUC29543 zone)

EMBL: CP001044.PE299

CP001044.PE299       Location/Qualifiers
FT   CDS_pept        342813..343724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3414"
FT                   /product="Phage-related protein predicted endonuclease-like
FT                   protein"
FT                   /note="KEGG: bld:BLi01440 YqaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3414"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72568"
FT                   /db_xref="GOA:B2JL39"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR017482"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL39"
FT                   /protein_id="ACC72568.1"
FT                   /translation="MNTQRDAWLELRRKGIGGSDAAAALGQSRHKTSFQLYQEKTDDTF
FT                   DIVVSSEHAERMRFGQRMEAVIADEYAERYGVKLRRHNRIAHHPRYGFMLANYDRTIDG
FT                   RREGLEAKNVDALSYRFGEWGEPGSDMIPPEYMLQCAHYLSVSGYDVWHLAACIGGNRL
FT                   EVYHVERDAEMIELIEEGEATFWKHIERKEAPSLDYQHASAIPLLKRMYSGTNGATIKL
FT                   PAEAVALHFSKLDFDEQEKLMHAGSEAARARLLHMMGNASIGLLPNGGSYRRKIVERKG
FT                   YEVEPVEYVDFRYSKKGGHGDE"
     atgaacacgc agcgagacgc gtggcttgag cttcgtcgta aaggcatcgg cggcagtgat        60
     gcggcggcgg cgctcggcca gtcgcgccac aaaacgagct tccagcttta tcaagaaaaa       120
     accgatgaca cgttcgatat tgtcgtgtcg tccgagcacg cggaacgcat gcgcttcggc       180
     cagcgcatgg aagcggtcat tgccgacgag tacgccgaac gctatggcgt gaagctgcgc       240
     cgccacaacc ggatcgcgca tcacccgagg tacggcttca tgctcgcgaa ctatgaccga       300
     acgatcgacg gccggcgcga aggactggaa gcgaaaaacg ttgatgcgct gtcgtatcgc       360
     ttcggcgaat ggggcgagcc gggaagcgac atgatcccgc cggaatacat gctgcaatgc       420
     gcccactacc tgtccgtatc gggctatgac gtgtggcatc tggcggcatg tatcggcggc       480
     aaccgcctcg aggtgtacca cgtcgagcgc gacgcagaga tgatcgaact gatcgaggaa       540
     ggcgaagcca cgttctggaa gcacatcgaa cgcaaggaag cgccgtcgct cgattaccag       600
     cacgcgagcg cgatcccgct gctcaagcgc atgtacagcg gcaccaacgg cgcgacgatc       660
     aagctgcctg ccgaagcggt cgcgctgcac ttctcgaagc tggacttcga cgagcaggaa       720
     aagctcatgc acgcggggtc cgaagcggcg cgcgcgcggt tgctgcacat gatgggcaat       780
     gcgtcgatcg gtttgttgcc gaacggcggc tcgtatcgcc gcaagatcgt cgagcgcaag       840
     ggctatgagg tcgagccggt cgaatacgtc gacttccgtt attcgaagaa gggaggacac       900
     ggcgatgaat ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page