(data stored in ACNUC29543 zone)

EMBL: CP001044.PE3

CP001044.PE3         Location/Qualifiers
FT   CDS_pept        1620..2570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3104"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: dar:Daro_1083
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3104"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72272"
FT                   /db_xref="GOA:B2JR46"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR46"
FT                   /protein_id="ACC72272.1"
FT                   /translation="MTKTRAILRAIFGIHHAHEPAARRDAASRSVMMRVTLDAQHVTPL
FT                   RRALTRDCAGQPWTIRIATLPHTERVQLSLYLPKDAVHGAIQQVTRIAPAAQFGHLFEI
FT                   PDTPTDGWRDLLRASSWAQAASVLRPAKPARTSEADDIETLDRLLGAGNVLLDADIADR
FT                   DALFAQLGAFCASRYGVPASQVIDGLNKREALGSTGLGQGVAVPHSQIAGLLSAVVLYV
FT                   RPRVPLDFDAPDAKPVSDVIALLVPEGANTMHLNLLADVAQRFCDQHFRERLHACGSAS
FT                   EVCRLFANAAQASGLASAIPHAASRGDASGAQLRA"
     atgacgaaga cccgagcgat cctgcgcgcc attttcggca tccatcatgc tcacgaaccg        60
     gccgcgcgac gtgacgcggc aagccgcagc gtgatgatgc gcgtgacgct cgacgcgcaa       120
     cacgtcacgc cgttgcgtcg cgcgctcacg cgcgattgcg cgggccagcc gtggacgatc       180
     cgcatcgcga cgctgccgca taccgagcgc gtgcaattgt cgctctatct gccgaaagac       240
     gcggtgcatg gtgcgatcca acaggtgacg cgaatcgcgc ccgctgcgca gttcggtcat       300
     ctgttcgaga ttcccgatac gccgacggac ggctggcgcg acctgctgcg cgcctcgtcg       360
     tgggctcagg ctgcgagcgt gctgcgcccg gcgaagcccg ccagaaccag cgaagccgac       420
     gacatcgaaa cgctcgaccg tctgctgggc gccgggaacg tgctgctcga tgccgacatt       480
     gccgatcgcg acgcactctt cgcgcaactc ggcgcgttct gcgcaagccg ctatggcgtg       540
     ccagcgagcc aggtgatcga cggcctgaac aagcgagaag cgctcggctc gaccgggctc       600
     ggacaaggtg tcgccgtgcc gcatagccag atcgcgggcc tgttgagcgc cgtggttctc       660
     tatgtgcggc cgcgtgtgcc gctcgatttc gacgcacccg acgcgaagcc cgtcagtgac       720
     gtcattgcgt tgctcgtgcc cgaaggcgcg aacacgatgc atctgaatct gctcgcggat       780
     gtcgcgcagc gcttctgcga tcagcatttt cgcgagcgcc tgcacgcatg cggcagtgca       840
     agcgaagtct gccggctgtt cgccaacgcc gcccaggcgt ccgggctggc gtcggcgata       900
     ccgcatgccg cctcacgcgg cgacgcctcc ggcgcacaac tcagggcgtg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page