(data stored in ACNUC29543 zone)

EMBL: CP001044.PE303

CP001044.PE303       Location/Qualifiers
FT   CDS_pept        345493..346017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpe:BP0507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3418"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72572"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL43"
FT                   /protein_id="ACC72572.1"
FT                   /translation="MLDFIRHPVRILHLNVRTEVHGDEERTAVDIKLGFDLPNRALDKL
FT                   SPSLRASLYEVLDDPNLPVLGPDGQHLTHVKNPQLGTLKWAGEYAPVGLHFHTGNGRSA
FT                   KGDLLFPEATFGKLAITAKEGGTCACVARAQILPNPDETAKLVGLLKHEIPATLDSAGA
FT                   VDTEVEGADDE"
     atgctggact tcatcagaca tccggtgcgc atcctgcatc tgaacgtgcg aactgaagtg        60
     catggcgacg aagaacggac cgccgtcgat atcaagctcg ggttcgatct accgaaccgc       120
     gcgctggaca agctaagtcc gtcgctgcgc gcctcgctct acgaggtact cgacgatccc       180
     aaccttccgg tactcgggcc ggacggccag cacctgacgc acgtgaaaaa cccgcagttg       240
     ggtacgctca aatgggcggg cgaatacgcg cctgtgggtc tgcatttcca tacgggcaac       300
     ggccgcagcg cgaagggtga tctgctcttt cccgaagcta cgttcggcaa gctggcgatt       360
     accgcgaagg aaggcgggac gtgtgcatgc gtggcgcgtg cgcagatcct gccgaacccc       420
     gacgaaaccg ccaagctggt cggcctgctc aagcacgaga tcccggccac gctcgattca       480
     gcgggcgcgg tcgataccga agtcgaaggc gcggacgatg aatga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page